KEGG   Pyrococcus abyssi: PAB0280
Entry
PAB0280           CDS       T00024                                 

Symbol
rbsk
Name
(GenBank) rbsK ribokinase
  KO
K21056  alpha-D-ribose-1-phosphate 5-kinase (ADP) [EC:2.7.1.212]
Organism
pab  Pyrococcus abyssi
Brite
KEGG Orthology (KO) [BR:pab00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PAB0280 (rbsk)
Enzymes [BR:pab01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.212  alpha-D-ribose-1-phosphate 5-kinase (ADP)
     PAB0280 (rbsk)
SSDB
Motif
Pfam: PfkB
Other DBs
NCBI-ProteinID: CAB49340
UniProt: Q9V1K9
Position
403462..404343
AA seq 293 aa
MRFDVICMGNLNYDIVFLMEKFPGIHEKVNAKGVFTGLGGSAGNTATWLAKLGLKVGFIG
AVGNDDFGRLHLEFFREIGVDTSGIKVVNDATGIAVTMVKGEDKRIVKYPGANRWKEVNT
EYLKRARHLHLSSNPIELIREAVEKAKELGLTVSFDPGEMEVPRDVEKELDILMMNEDEF
KAKYGSLDRIKDVKARIAIATLNGGGALVRDEKGEVHEVRGLSAKAIDTTGGGDAFNAGF
LYGFLSGWDVVNSAKLGMLLAYLTVQEVGARSAVRPLDEIKKIAQELKLNLPI
NT seq 882 nt   +upstreamnt  +downstreamnt
atgaggtttgacgtaatctgtatgggaaatttaaactacgacatagtctttctaatggag
aagttccctgggatccatgagaaggtcaacgctaaaggtgtttttacgggacttgggggt
tcggctggaaatactgcgacttggctggctaagctagggttgaaggttggcttcattggg
gcagttggaaacgatgactttggaaggcttcacctcgagttctttagggaaattggcgta
gatactagtggtataaaggttgtgaacgatgcaaccgggatagcggttactatggttaaa
ggggaagataagaggatagtcaagtatcctggggccaacaggtggaaggaagtaaacacc
gagtacctcaagagggctagacaccttcacctatcctcaaatccaattgaacttatcagg
gaagccgttgagaaggcgaaggagcttggcttgaccgtttcctttgaccctggggagatg
gaagttcccagggacgttgaaaaagagctagacatcttgatgatgaacgaggatgagttc
aaggcgaaatatggaagcttggacagaataaaggatgtaaaagctagaatagctatagcc
acgctgaacggtggaggggctcttgttagggatgaaaaaggagaggttcacgaggttagg
ggactctcagcaaaagccatagatacaactggagggggtgacgcattcaatgccggcttt
ctctatggcttccttagtggatgggatgtcgttaattcagcaaagcttggaatgctgctc
gcttatctaactgttcaggaggttggggctagaagcgctgtgaggccattagatgagatc
aagaaaatagcccaggaactaaagctgaaccttccaatttag

DBGET integrated database retrieval system