KEGG   Syntrophotalea acetylenica: A6070_04635
Entry
A6070_04635       CDS       T04585                                 

Name
(GenBank) hypothetical protein
  KO
K20625  acetylene hydratase [EC:4.2.1.112]
Organism
pace  Syntrophotalea acetylenica
Pathway
pace00625  Chloroalkane and chloroalkene degradation
pace01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pace00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A6070_04635
Enzymes [BR:pace01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.112  acetylene hydratase
     A6070_04635
SSDB
Motif
Pfam: Molybdopterin Molydop_binding MoeA_C
Other DBs
NCBI-ProteinID: APG43490
UniProt: A0A1L3GHJ8
Structure
PDB: 
2E7Z

Position
1031368..1033560
AA seq 730 aa
MASKKHVVCQSCDINCVVEAEVKADGKIQTKSISEPHPTTPPNSICMKSVNADTIRTHKD
RVLYPLKNVGSKRGEQRWERISWDQALDEIAEKLKKIIAKYGPESLGVSQTEINQQSEYG
TLRRFMNLLGSPNWTAAMYMCIGNTAGVHRVTHGSYSFASFADSNCLLFIGKNLSNHNWV
SQFNDLKAALKRGCKLIVLDPRRTKVAEMADIWLPLRYGTDAALFLGMINVIINEQLYDK
EFVENWCVGFEELKERVQEYPLDKVAEITGCDAGEIRKAAVMFATESPASIPWAVSTDMQ
KNSCSAIRAQCILRAIVGSFVNGAEILGAPHSDLVPISKIQMHEALPEEKKKLQLGTETY
PFLTYTGMSALEEPSERVYGVKYFHNMGAFMANPTALFTAMATEKPYPVKAFFALASNAL
MGYANQQNALKGLMNQDLVVCYDQFMTPTAQLADYVLPGDHWLERPVVQPNWEGIPFGNT
SQQVVEPAGEAKDEYYFIRELAVRMGLEEHFPWKDRLELINYRISPTGMEWEEYQKQYTY
MSKLPDYFGPEGVGVATPSGKVELYSSVFEKLGYDPLPYYHEPLQTEISDPELAKEYPLI
LFAGLREDSNFQSCYHQPGILRDAEPDPVALLHPKTAQSLGLPSGEWIWVETTHGRLKLL
LKHDGAQPEGTIRIPHGRWCPEQEGGPETGFSGAMLHNDAMVLSDDDWNLDPEQGLPNLR
GGILAKAYKC
NT seq 2193 nt   +upstreamnt  +downstreamnt
atggctagcaagaagcacgttgtctgtcagtcctgcgacattaattgtgttgtagaggct
gaagtgaaggctgacggtaagatccaaacaaagagtatctcagagcctcacccgacaact
ccccccaatagtatttgtatgaagtcggtgaatgcggacacgatcaggactcataaggat
cgtgtgctctatcctctgaaaaacgtgggtagtaagaggggagagcaaaggtgggagcga
atcagttgggaccaggcattggatgaaattgccgaaaagttgaaaaagattatagcgaaa
tacggtccggagtcccttggtgtaagccagactgagattaatcagcaaagcgaatatgga
acgctccggagattcatgaatctcttgggtagcccgaactggactgccgccatgtatatg
tgtatcgggaatacagccggagttcatagagtaactcatggaagttactcttttgcgagt
tttgccgactctaattgccttttgttcattggtaaaaatctcagtaatcataattgggtc
tcccagttcaatgaccttaaggctgctttaaaaagaggctgcaagcttattgtgcttgat
ccgcgcagaaccaaggtcgcagagatggcggatatttggcttcctcttcggtatggaaca
gatgcagctctatttctcgggatgattaacgttatcatcaatgaacagttgtacgacaaa
gagtttgttgaaaactggtgtgttgggtttgaagagcttaaagaacgggttcaggaatat
cctttagacaaagttgcggaaataaccggatgcgatgctggagaaatcaggaaagcggct
gttatgttcgcaactgagagtcccgcatccataccttgggctgtttcaactgatatgcag
aaaaatagttgttcggcgatccgcgcccaatgtattttaagggcaattgtcggcagcttt
gtgaatggagcggagattttgggggcccctcattcggatctggtgcccatttccaaaatt
cagatgcacgaagcactgcctgaagaaaagaaaaaacttcagctcggtacagagacgtac
ccgttccttacatacacggggatgagcgcgttggaagagccgtcagaaagagtgtatggg
gtgaaatatttccataatatgggcgcgtttatggccaacccgactgctctttttacggct
atggctaccgaaaaaccgtatcctgtaaaggccttttttgcgctcgccagcaatgcgctg
atgggctatgcaaatcagcaaaacgcacttaagggcctcatgaatcaggatttggttgtt
tgttatgatcagttcatgacgcctacagcgcagcttgccgattatgttctccctggtgac
cactggctggagaggcctgttgtccagccgaattgggagggcattcctttcggcaatact
tcccagcaagttgtcgaaccggctggcgaagccaaggatgagtattacttcatccgagag
ctggccgtcaggatgggccttgaagagcatttcccatggaaggaccggcttgaattgatc
aactataggataagcccgactggtatggagtgggaagagtaccagaaacaatacacctat
atgtctaagctgcctgattactttggaccggagggggtaggcgtagcgactccatcagga
aaagttgagctgtattcaagtgtatttgaaaagcttggttatgatccattgccgtactac
catgagccgctgcagactgaaataagtgatccggaacttgcgaaggaatatcctttaatc
ctttttgctggtctgcgtgaagattcaaactttcaatcgtgttatcaccagcctgggata
cttagagacgcagagcccgatcctgttgccttgcttcatccaaaaactgcgcagtccctt
ggacttccctccggcgaatggatctgggttgagacaactcatgggaggttgaagttgctc
ctcaagcatgatggtgcgcagccggaaggtacgataagaataccccatggacggtggtgc
cctgaacaggaaggggggcctgagactggatttagtggagccatgctgcataatgatgcc
atggtattaagtgatgatgactggaatctcgatccggagcagggtttgccaaatcttaga
ggcggtattcttgcgaaggcatataaatgctga

DBGET integrated database retrieval system