KEGG   Pseudomonas aeruginosa PAO1: PA0984
Entry
PA0984            CDS       T00035                                 
Name
(RefSeq) colicin immunity protein
Organism
pae  Pseudomonas aeruginosa PAO1
SSDB
Motif
Pfam: Microcin
Other DBs
NCBI-GeneID: 878363
NCBI-ProteinID: NP_249675
UniProt: Q9I4Y5
Position
1065970..1066296
AA seq 108 aa
MSFKYYWAKFFWGAFFFVLVAWKGSVFPSLASVNPLVVAGLSTILFPFSVKLVEDFALKY
TEREFWVTGFFSETPAKTGLYAVFYLSCYLFSIPLGMVFLFYKYGKAS
NT seq 327 nt   +upstreamnt  +downstreamnt
ttgagctttaaatactattgggctaagtttttctggggagctttcttctttgttttagtg
gcttggaaaggctccgtatttcccagcctggcatcagttaaccccttggtagtggctggg
ctcagtactatcctgtttcctttctcggtaaagcttgttgaagacttcgctttaaaatat
acggaaagagagttctgggtcacgggttttttctccgaaacccctgccaaaacaggtttg
tatgcagtcttttatttgtcttgttatttgttttcaattcccttggggatggttttttta
ttctataagtatggaaaggcctcgtag

DBGET integrated database retrieval system