KEGG   Pseudomonas aeruginosa PAO1: PA3150
Entry
PA3150            CDS       T00035                                 
Symbol
wbpG
Name
(RefSeq) LPS biosynthesis protein WbpG
  KO
K24326  aminotransferase
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00541  O-Antigen nucleotide sugar biosynthesis
pae01100  Metabolic pathways
pae01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PA3150 (wbpG)
SSDB
Motif
Pfam: QueC ATP_bind_3 Asn_synthase NAD_synthase tRNA_Me_trans DUF5836
Other DBs
NCBI-GeneID: 882581
NCBI-ProteinID: NP_251840
UniProt: Q9HZ78
Position
complement(3533948..3535081)
AA seq 377 aa
MMKICSRCVMDTSDAEIVFDEAGVCNHCHKFDNVQSRQLFSDASGEQRLQKIIGQIKKDG
SGKDYDCIIGLSGGVDSSYLAVKVKDLGLRPLVVHVDAGWNSELAVSNIEKIVKYCGFDL
HTHVINWEEIRDLQLAYMKAAVANQDVPQDHAFFASMYHFAVKNNIKYILSGGNLATEAV
FPDTWHGSAMDAINLKAIHKKYGERPLRDYKTISFLEYYFWYPFVKGMRTVRPLNFMAYD
KAKAETFLQETIGYRSYARKHGESIFTKLFQNYYLPTKFGYDKRKLHYSSMILSGQMTRD
EAQAKLAEPLYDADELQFDIEYFCKKMRITQAQFEELMNAPVHDYSEFANWDSRQRIAKK
VQMIVQRALGRRINVYS
NT seq 1134 nt   +upstreamnt  +downstreamnt
gtgatgaagatctgttcgcgctgtgttatggatacatctgacgctgaaatcgtatttgat
gaggcgggagtctgtaatcactgccataaatttgacaatgttcagtcccggcagctgttt
tccgatgctagtggtgagcagcgccttcaaaagataattgggcagatcaagaaggacggt
tcaggtaaggattatgactgcatcattggccttagtggcggcgtagatagttcctatctt
gctgtaaaggtcaaggatcttggcttgcgcccactggttgtgcatgtggacgccggctgg
aatagcgaacttgcagtcagtaatattgaaaagattgtaaaatattgcggttttgattta
catactcatgtaataaactgggaggaaattcgtgatcttcagttggcttatatgaaagct
gctgtcgccaatcaggatgtgcctcaagatcatgccttcttcgctagtatgtatcacttt
gctgtgaagaataatattaagtacattctgagtggtggtaatttggccactgaggcagta
ttcccagatacatggcacggcagcgctatggatgcaataaacctaaaggctattcacaaa
aaatatggtgagcgtccgctaagggactacaagactattagttttcttgagtactatttc
tggtatccctttgtcaaaggaatgagaacggtccgtccgttgaatttcatggcctatgat
aaggccaaggctgaaaccttccttcaagaaacgataggctatcgttcttacgcgcgaaag
catggagagtcgattttcaccaagcttttccagaactactatctaccgaccaagtttggc
tatgataaacgcaaactgcactactccagcatgattttgtctgggcaaatgacgcgtgac
gaagctcaggctaaactggctgagccgctatatgatgcagatgaactgcagtttgatatc
gaatatttctgcaagaagatgcgaatcacccaggctcaatttgaagagttgatgaatgca
cctgttcatgactattcggagtttgccaactgggattctcgacagaggattgcgaaaaaa
gttcaaatgattgtccagcgtgcgctgggtcgtcgcatcaatgtctactcgtga

DBGET integrated database retrieval system