KEGG   Pseudomonas aeruginosa PAO1: PA4224
Entry
PA4224            CDS       T00035                                 

Symbol
pchG
Name
(RefSeq) pyochelin biosynthetic protein PchG
  KO
K12241  pyochelin biosynthesis protein PchG
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae01053  Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    PA4224 (pchG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pae01008]
    PA4224 (pchG)
Polyketide biosynthesis proteins [BR:pae01008]
 Nonribosomal peptide tailoring proteins
  Reductase
   PA4224 (pchG)
SSDB
Motif
Pfam: GFO_IDH_MocA
Other DBs
NCBI-GeneID: 880082
NCBI-ProteinID: NP_252914
UniProt: G3XCL0 Q9HWG5
Position
complement(4730323..4731372)
AA seq 349 aa
MSDVRSVVVAGSRFGQFYAAGVAADPRFVLRGILGQGSRRSRALAERLGVETWCEVEALP
DDVRLACVAVGGAARGEQGPALAEALMARGIDVLIEHPLLPREWQDLLRSAERLGRRCLL
NTFYPQLPAVARFIELGRQLHRRRGIRHLDAACGVQVGFATLDILAALLEGVGPWSLESP
SNDLSAMRGLSLVLAEVPLSLLVLNELAAADDGRMTLLQRVSLTTDRGTLSLLSPHGPLL
WTPAVAVPAEDDDGLFALFDEIAGEPLPSAQLWYAEPCSWAQVHQRLWPAAAAEALALLA
DGDEVRRRNQRSLEVAALWQRIGERLGFPEAPPASLAPASLEQVLEQAS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgagcgacgtccgttccgtggtggtcgccggttcccggttcggccagttctatgccgcc
ggcgtcgccgccgatccgcgcttcgtcctgcgcggcatccttggccagggcagccggcgt
tcgcgggcgttggccgaacgcctcggggtggagacctggtgcgaggtcgaggcgttgccc
gacgatgtccgcctggcctgcgtcgcggtcggcggcgcggcacgcggcgagcagggcccg
gcgctggccgaggcgctgatggcgcgtggcatcgacgtgctgatcgagcatccgttgctg
ccgcgcgaatggcaggacctgctgcgcagcgccgagcgcctgggccggcgctgcctgctc
aacaccttctatccgcagttgccggcggtggcgcgtttcatcgagctgggccgccagttg
catcgccggcgcggcatccgccacctggacgcggcctgcggggtgcaggtcggtttcgcc
accctggacatcctcgccgcgttgctggagggcgttggcccctggtcgctggagtcgccc
tcgaacgacctgtcggcgatgcgcgggctgtccctggtgttggcggaagtgccattgagc
ctgctcgtgctcaacgaactggcggccgccgacgacgggcgcatgaccttgttgcagcgc
gtcagcctgaccaccgatcgcggcacgctgagcctgctcagcccccatggcccgttgttg
tggacgcctgcggtggcggtaccggcagaggatgacgacggcctgttcgcgctgttcgac
gagatagccggcgaaccgctgcccagcgcccagctctggtatgccgaaccgtgcagctgg
gcccaggtgcaccagcgcctgtggccggcggcggcggccgaggcgctggcgctgctcgcc
gacggcgacgaggtgcgccggcgcaaccagcgcagcctggaggtcgccgccctgtggcag
cggatcggcgagcgccttggcttccccgaggcgccgccggcgtcgctggcgccggcgagc
ctggaacaggtgctggagcaagcctcgtga

DBGET integrated database retrieval system