KEGG   Pseudomonas aeruginosa PAO1: PA4226
Entry
PA4226            CDS       T00035                                 

Symbol
pchE
Name
(RefSeq) dihydroaeruginoic acid synthetase
  KO
K12239  L-cysteine---[L-cysteinyl-carrier protein] ligase PchE [EC:6.2.1.69]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae01053  Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    PA4226 (pchE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pae01008]
    PA4226 (pchE)
Enzymes [BR:pae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.69  L-cysteine---[L-cysteinyl-carrier protein] ligase
     PA4226 (pchE)
Polyketide biosynthesis proteins [BR:pae01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Pyochelin synthetase
    PA4226 (pchE)
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding Methyltransf_12 AMP-binding_C Methyltransf_11 Methyltransf_31
Other DBs
NCBI-GeneID: 880048
NCBI-ProteinID: NP_252916
UniProt: O85739 G3XCV2
Position
complement(4736795..4741111)
AA seq 1438 aa
MDLPPDSRTALRDWLTEQLADLLGEPLADVRALADDDDLLGCGLDSIRLMYLQERLRARG
STLDFAQLAQRPCLGAWLDLLACADRLSAPATVALPTAQDRDQPFELSSVQQAYWLGRGA
GEVLGNVSCHAFLEFRTRDVDPQRLAAAAECVRQRHPMLRARFLDGRQQILPTPPLSCFD
LQDWRTLQVDEAERDWQALRDWRAHECLAVERGQVFLLGLVRMPGGEDRLWLSLDLLAAD
VESLRLLLAELGVAYLAPERLAEPPALHFADYLAHRAAQRAEAAARARDYWLERLPRLPD
APALPLACAPESIRQPRTRRLAFQLSAGESRRLERLAAQHGVTLSSVFGCAFALVLARWS
ESAEFLLNVPLFDRHADDPRIGEVIADFTTLLLLECRMQAGVSFAEAVKSFQRNLHGAID
HAAFPALEVLREARRQGQPRSAPVVFASNLGEEGFVPAAFRDAFGDLHDMLSQTPQVWLD
HQLYRVGDGILLAWDSVVGLFPEGLPETMFEAYVGLLQRLCDSAWGQPADLPLPWAQQAR
RALLNGQPACATARTLHRDFFLRAAEAPDADALLYRDQRVTRGELAERALRIAGGLREAG
VRPGDAVEVSLPRGPQQVAAVFGVLAAGACYVPLDIDQPPARRRLIEEAAGVCLAITEED
DPQALPPRLDVQRLLRGPALAAPVPLAPQASAYVIYTSGSTGVPKGVEVSHAAAINTIDA
LLDLLRVNASDRLLAVSALDFDLSVFDLFGGLGAGASLVLPAQEQARDAAAWAEAIQRHA
VSLWNSAPALLEMALSLPASQADYRSLRAVLLSGDWVALDLPGRLRPRCAEGCRLHVLGG
ATEAGIWSNLQSVDTVPPHWRSIPYGRPLPGQAYRVVDTHGRDVPDLVVGELWIGGASLA
RGYRNDPELSARRFVHDAQGRWYRTGDRGRYWGDGTLEFLGRVDQQVKVRGQRIELGEVE
AALCAQAGVESACAAVLGGGVASLGAVLVPRLAPRAEGSMDLPAAQPFAGLAEAEAVLTR
EILGALLEAPLELDDGLRRRWLDWLADSAASALPSLDEALRRLGWQAAGLTAMGNALRGL
LAGEQAPAALLLDPWLAPQAVAARLPDGREALARLLEALPTPAAGERLRVAVLDTRAGLW
LDQGMASLLRPGLELTLFERSRVLLDAAATRLPERIVVQALDDGLLPAEHLGRYDRVISF
AALHAYEASREGLALAAALLRPQGRLLLVDLLCESPLALLGAALLDDRPLRLAELPSLLA
DLAAAGLAPRCLWRSERIALVEALAPGLGLDAAALQAGLEQRLPQAMRPERLWCLPSLPL
NGNGKVDRRRLAESMTRALGECRHEPSAEEPLEAHEQALAECWEAVLKRPVRRREASFFS
LGGDSLLATRLLAGIRERFGVRLGMADFYRQPTLAGLARHLQVQTVEIEETQLEEGVL
NT seq 4317 nt   +upstreamnt  +downstreamnt
atggatctgccccccgattcccgtaccgccctgcgcgactggctgaccgagcagctcgcc
gacctgctcggcgaaccgcttgctgacgtgcgcgccctggcggacgacgacgacctgctg
ggctgcggcctcgactcgatccgcctgatgtacctgcaggaacgcctgcgcgcgcgtggc
tcgacgctggacttcgcccagttggcgcagcgcccctgcctgggggcctggctcgacctg
ctggcctgcgcggaccggctgtccgccccggcaacggtcgcgctgccgacggcgcaggat
cgcgatcagccgttcgagctgtcttccgtgcagcaggcctactggctgggacgtggcgcc
ggcgaggtgctgggcaacgtcagctgccatgcctttctggaattccgcacgcgggatgtc
gacccgcagcgcctggccgcggcggcggagtgcgtgcgtcaacgccacccgatgttgcgg
gcgcgcttcctcgacggtcgccagcagatccttccgacgccgccgctgtcctgcttcgac
ctgcaggactggcgcaccttacaggtggacgaggccgagcgcgactggcaggcgctgcgc
gactggcgcgcccatgaatgcctggcggtggagcgcggccaggtgttcctgctcgggctg
gtgcgcatgccgggcggcgaggatcgcctctggctgagtctcgacctgcttgccgccgat
gtcgaaagcctgcgcctgctgctggccgaactgggcgttgcctacctggcgccggagcgc
ctggcggagccgccggcgctgcatttcgccgactacctggcgcaccgtgcggcgcaacgc
gccgaggccgcggcgcgggcccgcgactactggctggaacgcctgccgcgcttgccggac
gcgccggccctgccgttggcctgcgcgccggaaagcatccgccagccgcgcacccggcgc
ctggcattccagctttccgccggcgagagccggcgcctggagcgtcttgccgcgcagcat
ggcgtgaccttgtccagcgtgttcggctgcgccttcgcgctggtcctggcgcgctggagc
gaaagcgcggaatttctcctcaacgtgccgttgttcgatcggcatgccgacgacccgcgt
atcggcgaggtgatcgccgacttcaccaccctgttgctgctggagtgccggatgcaggcc
ggggtgtccttcgccgaggcggtgaagagcttccagcgcaacctccacggagccatcgac
cacgccgcattccccgccctggaggtgctccgcgaggcgcgccggcagggccagccacgc
tcggcgccggtggtgttcgccagcaacctgggcgaggagggcttcgtcccggcggccttc
cgcgacgctttcggcgatctccacgacatgctctcgcagaccccgcaggtctggctcgac
caccagctctaccgggtgggcgacggtatcctgctggcctgggatagcgtcgtcggcctg
ttccccgaaggtctgccggaaaccatgttcgaagcctacgtggggctgctccagcgtctc
tgcgacagcgcctgggggcagcccgccgatctgccgttgccctgggcgcagcaggcgcgc
cgggccctgctcaacggccagccggcatgcgccacggcgcgcaccctgcatcgcgacttc
ttccttcgcgccgccgaggcgccggatgccgacgcgctgctctatcgcgaccaacgtgtc
acccgcggcgaactggccgagcgtgcgctgcgcatcgccggcggcctgcgcgaagccggg
gtgcgccctggcgacgcggtcgaggtcagcctgccgcgcggaccgcagcaggtcgcggcg
gtattcggcgtgctcgccgcaggcgcctgctacgtgccgctggacatcgaccagccgccc
gcacggcggcgcctgatcgaagaggccgccggggtatgcctggcgatcaccgaggaggac
gatccgcaggccttgccgccgcgcctggatgtccagcgcctgctgcgcggcccggcgctg
gccgcccccgtgccgctggcgccgcaggcgagtgcctatgtgatctacacctcgggctcc
accggggtgcccaagggcgtcgaggtcagccacgcggcggcgatcaataccatcgacgcg
ctgctcgacctgctgcgggtgaacgcatcggatcgcttgctggcggtctccgcgctggac
ttcgatctgtcggtcttcgacctgttcggcggcctcggcgccggtgccagcctggtcctg
ccggcccaggaacaggcgcgcgatgccgctgcctgggcggaggctatccagcggcatgcg
gtgagcctgtggaactcggcgccggccttgctggagatggccctcagcctgccggcgagc
caggccgactatcgcagtctgcgggcggtgctgctgtccggcgactgggtggccctggac
ctgcccggccgcctgcgcccacgttgtgccgaaggctgccgcctgcatgtgctgggtggc
gctaccgaagcgggcatctggtcgaacctgcagagcgtcgatacggtgccgccgcactgg
cgttcgattccctacggccggccattgccgggacaggcctaccgggtggtcgacacccac
gggcgcgacgtgccggacctggtggtcggcgagctgtggatcggcggcgccagcctggcc
cgcggctatcgcaacgatcccgaactcagcgcccggcgtttcgtccacgatgcccagggc
cgctggtatcgcaccggcgatcgcggtcgctactggggcgacggtaccctggaattcctc
ggtcgggtcgaccagcaggtgaaagtgcgcggccagcgcatcgagttgggcgaggtggag
gccgcgctgtgcgcccaggctggcgtggagagcgcctgcgcggcggtgctcggcggtggc
gtggcgagcctcggcgcggtgctggtaccgcgcctggcgccacgggccgaaggctccatg
gatctaccggccgcacagcccttcgccggcctggcagaggccgaggcggtactcacccgg
gaaatcctcggcgcgctgctggaggcgccgctggagctagacgacggtttgcgccggcgc
tggctggactggctagcggactccgccgccagcgcgctgccgtcgctcgacgaggcgttg
cgccggctcggctggcaggccgcggggctgaccgcgatgggcaacgctctgcgcggcctg
ctcgccggcgaacaggcgccggccgcgctgctcctcgatccctggctggcgccgcaggcg
gtggccgcgcgcctgccggacggccgcgaggccctggcgcgcctgctcgaagcgctgccg
acgccggctgccggcgaacgcctgcgggtggcggtgctggatacccgcgccgggctctgg
ctcgaccagggcatggcctcgctgttgcgcccagggctggaactgaccctcttcgaacgc
agccgcgtcctcctcgacgccgccgccacccgcttgccggaacggatcgtggtgcaggcg
ctggacgacggcctgctacctgccgagcacctcggtcgctacgaccgggtgatcagcttc
gccgcgctgcacgcctacgaggccagccgcgaaggcctggcgctggcggcggcgctgctg
cgcccgcagggccgcctgttgctggtggacctgctatgcgagtcgccactggcgctgctc
ggtgcggccttgctcgacgaccggccgctgcgcctggcggagctgccgagcctgttggcc
gatctcgccgctgcgggactggcgccgcgttgcctgtggcgcagcgagcggatcgccctg
gtcgaggcgctggcaccgggactcgggctcgacgccgccgcgctccaggccggcctggag
caacgcctgccccaggcgatgcggcccgaacgcctgtggtgcctgccaagcctgccgttg
aacggcaatggcaaggtcgatcgtcgccgcctggccgagagcatgacccgcgcactcggc
gagtgtcgtcacgagccctcggcggaggagccgctggaagcccatgagcaagcgctggcc
gagtgctgggaagcggttctcaaacgcccggtgcgtcgtcgcgaggcgagcttcttcagc
ctcggcggcgacagcctgctggcgacccgcctgctggccggcatacgtgagcgtttcggc
gtacgcctgggcatggccgacttctatcgccagccgaccctggccggtcttgcccgccac
ttgcaggtgcagaccgtcgaaatcgaggaaacccaactggaagagggcgtgctatga

DBGET integrated database retrieval system