KEGG   Pseudomonas aeruginosa PAO1: PA4228
Entry
PA4228            CDS       T00035                                 

Symbol
pchD
Name
(RefSeq) 2,3-dihydroxybenzoate-AMP ligase
  KO
K12238  salicylate---[aryl-carrier protein] ligase [EC:6.2.1.61]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae01053  Biosynthesis of siderophore group nonribosomal peptides
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    PA4228 (pchD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pae01008]
    PA4228 (pchD)
Enzymes [BR:pae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.61  salicylate---[aryl-carrier protein] ligase
     PA4228 (pchD)
Polyketide biosynthesis proteins [BR:pae01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Pyochelin synthetase
    PA4228 (pchD)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C VWA_N2 GH3
Other DBs
NCBI-GeneID: 880566
NCBI-ProteinID: NP_252918
UniProt: Q9HWG3
Position
4742424..4744067
AA seq 547 aa
MTSSPVTPSAVDDAPDWPAAFVRRYLDAGHWQDQSFAEALATSAARHPRRIALCDDDQRL
SYADLLQRCRRLAAGLRQAGLAHGDTVVLHLPNGIAFVETCFALFQLGVRPVLALPAHRQ
HEISGFCRFAEAKAYIGAERIDGFDPRPMARELLASGACRMALIHGEAEAPLQALAPLYQ
ADALEDCAARAEDIACFQLSGGTTGTPKLIPRRHREYLYNVRASAEVCGFDEHTVYLTGL
PMAHNFTLCCPGVIGTLLASGRVVVSQRADPEHCFALIARERVTHTALVPPLAMLWLDAQ
ESRRADLSSLRLLQVGGSRLGSSAAQRVEPVLGCQLQQVLGMAEGLICYTRLDDPPERVL
HTQGRPLSPDDEVRVVDAEGREVGPGEVGELTVRGPYTIRGYYRLPEHNAKAFSADGFYR
TGDRVSRDKDGYLVVEGRDKDQINRGGEKIAAEEVENLLIAHPQVHDATVVAMPDSLLGE
RTCAFVIPRQPAPSALKLKQYLHACGLAAFKVPDRIELVPAFPQTGIGKISKKDLRERLR
RELEARA
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgacttcctcgcccgtcaccccatcggccgtcgacgacgcccccgactggcccgccgcc
ttcgtccgccgctatctcgacgccggccactggcaggaccagagcttcgccgaagccctg
gccaccagcgccgcgcgccatccgcggcggatcgcgctctgcgacgacgaccagcggctc
agctatgccgacctgctccagcgctgccgccgcctggcagccggactgcgccaggccggc
ctcgcacatggcgacacggtagtgctgcacctgcccaacggcatcgccttcgtcgagacc
tgcttcgccctgttccagctcggcgtacgcccggtgctcgccctccccgcccatcgccag
catgagatcagcggtttctgtcgcttcgccgaggccaaggcctacatcggcgccgaacgg
atcgacggcttcgacccacggccgatggcccgtgagctgctcgccagcggcgcctgccgg
atggcgctgatccacggcgaagccgaggcgccgctgcaagcgctggcaccgctgtaccag
gccgacgcgctggaagactgcgccgcccgcgccgaggatatcgcctgcttccagttgtcc
ggcggcaccaccggcacgccgaagctgattccccggcgtcatcgcgagtatctctacaac
gtccgcgccagcgccgaggtctgcggcttcgacgagcacacggtgtacctcaccggcttg
ccgatggcgcacaacttcactctctgctgccccggagtgatcggcacgctgctggccagc
ggccgcgtggtggtcagccagcgcgccgatcccgagcattgcttcgccctgatcgcccgt
gaacgggtcacccacaccgccctggtaccgccgctggcgatgctctggctggatgcccag
gaaagccgccgcgccgatctatccagcctgcgtctgctccaggtcggcggctccaggctc
ggcagcagtgccgcgcaacgcgtcgaaccggtgctcggctgccagttgcaacaggtgctg
ggaatggccgaggggctgatctgctacacccgcctggacgatccgcccgaacgcgtgctg
catacccagggccggccgctgtcgccggacgacgaagtgcgggtggtcgacgccgagggc
cgcgaggtcggccccggcgaggtgggcgaactgaccgtgcgcggtccctacaccatccgc
ggctactaccgcctgcctgaacacaacgccaaggccttcagcgcggacggcttctaccgc
accggcgaccgggtcagccgcgacaaggacggctacctggtggtggagggccgcgacaag
gaccagatcaaccgcggcggcgagaagatcgccgcggaagaggtggagaacctgctgata
gcccatccgcaggtgcacgacgccaccgtcgtggcgatgcccgacagcctgctcggcgag
cgcacctgcgccttcgtcatcccgcgccagccggcgccctcggcgctgaagctgaagcaa
tacctgcacgcctgcgggctggccgcgttcaaggtgccggaccgcatcgagctggtcccg
gccttcccccaaaccggcatcggcaagatcagcaagaaggacctgcgcgagcgcctgcgc
cgcgagctggaggcccgcgcatga

DBGET integrated database retrieval system