KEGG   Pseudomonas aeruginosa PAO1: PA5161
Entry
PA5161            CDS       T00035                                 

Gene name
rmlB
Definition
(RefSeq) dTDP-D-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
pae  Pseudomonas aeruginosa PAO1
Pathway
pae00521  Streptomycin biosynthesis
pae00523  Polyketide sugar unit biosynthesis
pae00525  Acarbose and validamycin biosynthesis
pae00541  O-Antigen nucleotide sugar biosynthesis
pae01100  Metabolic pathways
pae01110  Biosynthesis of secondary metabolites
Module
pae_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:pae00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PA5161 (rmlB)
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    PA5161 (rmlB)
   01055 Biosynthesis of vancomycin group antibiotics
    PA5161 (rmlB)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    PA5161 (rmlB)
   00525 Acarbose and validamycin biosynthesis
    PA5161 (rmlB)
Enzymes [BR:pae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     PA5161 (rmlB)
SSDB
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 3Beta_HSD adh_short
Other DBs
NCBI-GeneID: 879982
NCBI-ProteinID: NP_253848
UniProt: Q9HU24
Position
5810281..5811339
AA seq 352 aa
MTILVTGSAGFIGANFVLDWLALHDEPVVSLDKLTYAGNRQNLASLDGDARHTFVAGDIG
DSQLVARLLAEHQPRAILNFAAESHVDRSIHGPEDFIQTNIVGTFRLLEEVRAYWGALEP
EAKAAFRFLHVSTDEVYGSLAPSDPAFTENNRYEPNSPYSASKAASDHLVRAYHHTYGLP
VLTTNCSNNYGPYHFPEKLIPLVIHNALAGKPLPIYGDGQQIRDWLYVKDHCSAIRRVLE
AGQLGETYNVGGWNEKANLDVVETLCAILDQEQPRADGRSYREQITFVKDRPGHDRRYAI
DATRLERELGWKPAETFETGIRKTVRWYLDNQDWVANVTSGAYREWVGKQYA
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgacgattctcgtgaccggcagcgccggcttcatcggcgccaatttcgtgctcgactgg
ctggccctgcatgacgagccggtggtcagcctcgacaagctcacctacgccggcaaccgg
cagaacctcgccagcctcgacggcgacgcccggcacaccttcgtcgccggcgatatcggc
gatagccagctggtagcccgcctgctcgccgagcaccagccgcgggcgatcctcaacttc
gccgcggaatcccatgtggaccgctcgatccacggccccgaggacttcatccagaccaac
atcgtcggcaccttccgcctgctggaagaagtgcgcgcctactggggcgcgctggagccg
gaagcgaaggcggcattccgcttcctccacgtctccaccgacgaagtctatggctcgctg
gcaccgagcgatccggccttcaccgagaacaaccgctacgagccgaacagtccctactcg
gcgtccaaggcggcctccgaccacctagtgcgggcctatcaccacacctatgggctgccg
gtgctgaccaccaactgctcgaacaactacggcccgtaccacttcccggaaaagctcatc
ccactggtgatccacaacgccctggccggcaagccgctgccgatctacggcgacggccag
cagatccgcgactggctctacgtcaaggaccattgcagcgccatccgccgggtcctcgaa
gccgggcaactgggcgagacctacaatgtcggcggctggaacgaaaaggccaacctcgac
gtggtcgagaccctctgcgccatcctcgaccaggagcagccgcgcgccgacggccgcagc
tatcgcgagcagatcaccttcgtcaaggatcgtccgggccatgatcgccgctacgccatc
gatgccacgcgcctggagcgcgagctgggctggaagccggcggaaaccttcgagaccggc
atccgcaagaccgtgcgctggtacctggacaaccaggactgggtggccaacgtaaccagc
ggtgcctaccgcgagtgggtgggtaagcagtacgcatga

DBGET integrated database retrieval system