KEGG   Paenibacillus sp. FSL R7-0331: R70331_20920
Entry
R70331_20920      CDS       T03357                                 
Name
(GenBank) hypothetical protein
Organism
paee  Paenibacillus sp. FSL R7-0331
SSDB
Motif
Pfam: YxiJ
Other DBs
NCBI-ProteinID: AIQ55536
UniProt: A0A089L237
Position
complement(4673017..4673403)
AA seq 128 aa
MSDQSATIKELALLYKSLHRSFPYQDSARLKEDFAAAFTHLKEESFNADLSEYCALIAGT
ISYVIHNSVTEIPQRQLALLRKSFFERYPAYAFIQPGLSEYPTISADLEAHERARGMLLR
IIKENKNL
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtcagaccaatcagcaaccattaaagaactagcactgctttataagagtttacaccgc
tcttttccttatcaagattcagcacgcttgaaggaggatttcgcagcagcttttacacat
ttaaaggaggaatcgttcaacgcagacttaagtgaatattgtgcgttgattgccggaacg
atcagttatgttattcataactccgttactgagattcctcagagacagcttgctttgtta
cgaaaaagcttttttgagcgctatccggcgtatgcttttatacagcctggattgtctgaa
tatccgacgatttcagcagatctggaggctcatgagcgtgccagggggatgctgcttaga
attataaaagaaaataaaaacttgtga

DBGET integrated database retrieval system