KEGG   Pseudomonas aeruginosa YL84: AI22_24240
Entry
AI22_24240        CDS       T03035                                 

Definition
(GenBank) UDP-glucose 4-epimerase
  KO
K24310  UDP-4-keto-D-QuiNAc 4-reductase [EC:1.1.1.-]
Organism
paeg  Pseudomonas aeruginosa YL84
Pathway
paeg00541  O-Antigen nucleotide sugar biosynthesis
paeg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paeg00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    AI22_24240
Enzymes [BR:paeg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     AI22_24240
SSDB
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10
Other DBs
NCBI-ProteinID: AHH51951
Position
complement(5246976..5247704)
AA seq 242 aa
MSETASDPLVEFRKANVQGTLDLAREAVSRGVRRFIFISSIKVNGEGTEPGRPYTADSPP
NPVDPYGVSKREAEQALLDLAEETGLEVVIIRPVLVYGPGVKANVQTMMRWLKRGVPLPL
GAIHNRRSLVSLDNLVDLIITCIEHPAAVGQVFLVSDGEDLSTTELLRRMGRALGAPARL
LPVPASWIGAAAKVLNRQAFARRLCGSLQVDIMKTRQVLGWTPPVGVDQALEKTARSFLD
RQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagcgagacggcctccgatccgctcgtcgagttccgcaaggccaacgttcaggggaca
cttgatctggcccgggaggccgtatcccggggagtgcggcgtttcatctttatcagctcg
ataaaggtcaatggcgagggaactgagcccggtcggccctatactgcggacagtccgccc
aatcctgtcgatccctatggcgtttccaaacgggaagcggagcaagcgctattggatctg
gcggaagagaccggactggaggttgtgatcatccgaccggtcctggtttatggtccaggg
gtcaaggccaacgtacagaccatgatgcgctggctgaagcgcggcgtgcccctccctcta
ggggctattcataatcggcgtagtctggtgtcgctggataatcttgtcgacctcatcatc
acctgcatcgagcatccggctgcggtcgggcaagttttcctcgtaagcgacggtgaggat
ctttccaccaccgagttgctgcggagaatgggacgcgccttgggcgctcccgctcgcctg
ctgcctgttcccgccagttggatcggtgcagcggcgaaagttctgaacaggcaggcattt
gctcgccgcctgtgcggctcattgcaagtcgatatcatgaaaacccgccaagtgcttggc
tggactccgccggtaggggtggaccaggcattggagaaaaccgcccgctctttcctggat
cgccaatga

DBGET integrated database retrieval system