KEGG   Pseudomonas aeruginosa PAO1-VE2: N296_3262
Entry
N296_3262         CDS       T03170                                 
Name
(GenBank) N-acetyl sugar amidotransferase family protein
  KO
K24326  aminotransferase
Organism
paei  Pseudomonas aeruginosa PAO1-VE2
Pathway
paei00541  O-Antigen nucleotide sugar biosynthesis
paei01100  Metabolic pathways
paei01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:paei00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    N296_3262
SSDB
Motif
Pfam: QueC ATP_bind_3 Asn_synthase tRNA_Me_trans NAD_synthase DUF5836
Other DBs
NCBI-ProteinID: AGY66641
Position
complement(3533943..3535073)
AA seq 376 aa
MKICSRCVMDTSDAEIVFDEAGVCNHCHKFDNVQSRQLFSDASGEQRLQKIIGQIKKDGS
GKDYDCIIGLSGGVDSSYLAVKVKDLGLRPLVVHVDAGWNSELAVSNIEKIVKYCGFDLH
THVINWEEIRDLQLAYMKAAVANQDVPQDHAFFASMYHFAVKNNIKYILSGGNLATEAVF
PDTWHGSAMDAINLKAIHKKYGERPLRDYKTISFLEYYFWYPFVKGMRTVRPLNFMAYDK
AKAETFLQETIGYRSYARKHGESIFTKLFQNYYLPTKFGYDKRKLHYSSMILSGQMTRDE
AQAKLAEPLYDADELQFDIEYFCKKMRITQAQFEELMNAPVHDYSEFANWDSRQRIAKKV
QMIVQRALGRRINVYS
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgaagatctgttcgcgctgtgttatggatacatctgacgctgaaatcgtatttgatgag
gcgggagtctgtaatcactgccataaatttgacaatgttcagtcccggcagctgttttcc
gatgctagtggtgagcagcgccttcaaaagataattgggcagatcaagaaggacggttca
ggtaaggattatgactgcatcattggccttagtggcggcgtagatagttcctatcttgct
gtaaaggtcaaggatcttggcttgcgcccactggttgtgcatgtggacgccggctggaat
agcgaacttgcagtcagtaatattgaaaagattgtaaaatattgcggttttgatttacat
actcatgtaataaactgggaggaaattcgtgatcttcagttggcttatatgaaagctgct
gtcgccaatcaggatgtgcctcaagatcatgccttcttcgctagtatgtatcactttgct
gtgaagaataatattaagtacattctgagtggtggtaatttggccactgaggcagtattc
ccagatacatggcacggcagcgctatggatgcaataaacctaaaggctattcacaaaaaa
tatggtgagcgtccgctaagggactacaagactattagttttcttgagtactatttctgg
tatccctttgtcaaaggaatgagaacggtccgtccgttgaatttcatggcctatgataag
gccaaggctgaaaccttccttcaagaaacgataggctatcgttcttacgcgcgaaagcat
ggagagtcgattttcaccaagcttttccagaactactatctaccgaccaagtttggctat
gataaacgcaaactgcactactccagcatgattttgtctgggcaaatgacgcgtgacgaa
gctcaggctaaactggctgagccgctatatgatgcagatgaactgcagtttgatatcgaa
tatttctgcaagaagatgcgaatcacccaggctcaatttgaagagttgatgaatgcacct
gttcatgactattcggagtttgccaactgggattctcgacagaggattgcgaaaaaagtt
caaatgattgtccagcgtgcgctgggtcgtcgcatcaatgtctactcgtga

DBGET integrated database retrieval system