KEGG   Pseudomonas aeruginosa LES431: T223_09640
Entry
T223_09640        CDS       T02970                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K24310  UDP-4-keto-D-QuiNAc 4-reductase [EC:1.1.1.-]
Organism
pael  Pseudomonas aeruginosa LES431
Pathway
pael00541  O-Antigen nucleotide sugar biosynthesis
pael01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pael00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    T223_09640
Enzymes [BR:pael01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     T223_09640
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR NmrA
Other DBs
NCBI-ProteinID: AHC64558
Position
2024132..2025094
AA seq 320 aa
MTRHNVLVTGATGFIGAALVNSLCSSGQYKVWAGCRRRGGAWPRGVTPLLLGELGSSVVW
DAESAIDTVVHCAARVHVMSETASDPLVEFRKANVQGTLDLAREAVSRGVRRFIFISSIK
VNGEGTEPGRPYTADSPPNPVDPYGVSKREAEQALLDLAEETGLEVVIIRPVLVYGPGVK
ANVQTMMRWLKRGVPLPLGAIHNRRSLVSLDNLVDLIITCIEHPAAVGQVFLVSDGEDLS
TTELLRRMGRALGAPARLLPVPASWIGAAAKVLNRQAFARRLCGSLQVDIMKTRQVLGWT
PPVGVDQALEKTARSFLDRQ
NT seq 963 nt   +upstreamnt  +downstreamnt
ttgacgcgacataatgtattggtaacgggggcaaccggattcatcggggccgcgctggtc
aatagtctctgttcttccgggcagtacaaggtttgggccgggtgccgccgaagaggtggg
gcctggcctcgaggggttactcccttgcttctgggtgaactgggcagttctgttgtctgg
gatgcggagtcggccatcgatacggtggttcattgcgctgcccgcgtgcatgtcatgagc
gagacggcctccgatccgctcgtcgagttccgcaaggccaacgttcaggggacacttgat
ctggcccgggaggccgtatcccggggagtgcggcgtttcatctttatcagctcgataaag
gtcaatggcgagggaactgagcccggtcggccctatactgcggacagtccgcccaatcct
gtcgatccctatggcgtttccaaacgggaagcggagcaagcgctattggatctggcggaa
gagaccggactggaggttgtgatcatccgaccggtcctggtttatggtccaggggtcaag
gccaacgtacagaccatgatgcgctggctgaagcgcggcgtgcccctccctctaggggct
attcataatcggcgtagtctggtgtcgctggataatcttgtcgacctcatcatcacctgc
atcgagcatccggctgcggtcgggcaagttttcctcgtaagcgacggtgaggatctttcc
accaccgagttgctgcggagaatgggacgcgccttgggcgctcccgctcgcctgctgcct
gttcccgccagttggatcggtgcagcggcgaaagttctgaacaggcaggcatttgctcgc
cgcctgtgcggctcattgcaagtcgatatcatgaaaacccgccaagtgcttggctggact
ccgccggtaggggtggaccaggcattggagaaaaccgcccgctctttcctggatcgccaa
tga

DBGET integrated database retrieval system