KEGG   Pseudomonas aeruginosa PA1: PA1S_09625
Entry
PA1S_09625        CDS       T02928                                 

Definition
(GenBank) NAD-dependent dehydratase
  KO
K24310  UDP-4-keto-D-QuiNAc 4-reductase [EC:1.1.1.-]
Organism
paep  Pseudomonas aeruginosa PA1
Pathway
paep00541  O-Antigen nucleotide sugar biosynthesis
paep01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paep00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PA1S_09625
Enzymes [BR:paep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PA1S_09625
SSDB
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NAD_binding_10 KR NmrA
Other DBs
NCBI-ProteinID: ALD84036
Position
2037287..2038249
AA seq 320 aa
MTRHNVLVTGATGFIGAALVNSLCSSGQYKVWAGCRRRGGAWPRGVTPLLLGELGSSVVW
DAESAIDTVVHCAARVHVMSETASDPLVEFRKANVQGTLDLAREAVSRGVRRFIFISSIK
VNGEGTEPGRPYTADSPPNPVDPYGVSKREAEQALLDLAEETGLEVVIIRPVLVYGPGVK
ANVQTMMRWLKRGVPLPLGAIHNRRSLVSLDNLVDLIITCIEHPAAVGQVFLVSDGEDLS
TTELLRRMGRALGAPARLLPVPASWIGAAAKVLKRQAFARRLCGSLQVDIMKTRQVLGWT
PPVGVDQTLEKTARSFLDRQ
NT seq 963 nt   +upstreamnt  +downstreamnt
ttgacgcgacataatgtattggtaacgggggcaaccggattcatcggggccgcgctggtc
aatagtctctgttcttccgggcagtacaaggtttgggccgggtgccgccgaagaggtggg
gcctggcctcgaggggttactcccttgcttctgggtgaactgggcagttctgttgtctgg
gatgcggagtcggccatcgatacggtggttcattgcgctgcccgcgtgcatgtcatgagc
gagacggcctccgatccgctcgtcgagttccgcaaggccaacgttcaggggacacttgat
ctggcccgggaggccgtatcccggggagtgcggcgtttcatctttatcagctcgataaag
gtcaatggcgagggaactgagcccggtcggccctatactgcggacagtccgcccaatcct
gtcgatccctatggcgtttccaaacgggaagcggagcaagcgctattggatctggcggaa
gagaccggactggaggttgtgatcatccgaccggtcctggtttatggtccaggggtcaag
gccaacgtacagaccatgatgcgctggctgaagcgcggcgtgcccctccctctaggggct
attcataatcggcgtagtctggtgtcgctggataatcttgtcgacctcatcatcacctgc
atcgagcatccggctgcggtcgggcaagttttcctcgtaagcgacggtgaggatctttcc
accaccgagttgctgcggagaatgggacgcgccttgggcgctcccgctcgcctgctgcct
gttcccgccagttggatcggtgcagcggcgaaagttctgaagaggcaggcatttgctcgc
cgcctgtgcggctcattgcaagtcgatatcatgaaaacccgccaagtgcttggctggact
ccgccggtaggggtggaccagacattggagaaaaccgcccgctctttcctggatcgccaa
tga

DBGET integrated database retrieval system