KEGG   Pseudomonas aeruginosa PA38182: BN889_06506
Entry
BN889_06506       CDS       T03031                                 

Definition
(GenBank) putative 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
paeu  Pseudomonas aeruginosa PA38182
Pathway
paeu00626  Naphthalene degradation
paeu01100  Metabolic pathways
paeu01120  Microbial metabolism in diverse environments
paeu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:paeu00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    BN889_06506
Enzymes [BR:paeu01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     BN889_06506
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Glutaredoxin
Other DBs
NCBI-ProteinID: CDI94515
Position
6781149..6781754
AA seq 201 aa
MNLQSVFDYRSPYAYLANTRLPEFDTPISYFAIDILEVMKKVNNQPSPACPAKAKYSGID
AARWAAVYGVPLAPNGAFFQAMRAGQVEGAILARAALAAQQTGSFEVVHPALFQAVWAGT
DDLITAEGRSTFLKNLGVDEDIWQLADRPAVRDQLAANNEEAARRGVFGVPTLFCGDEMF
FGNDRLDFVRAALQKAKGASK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaatctccagtccgtttttgattaccgaagcccttacgcttacctggccaacacccgc
ctgccagagttcgatacgcccatcagctacttcgccatcgacattttggaggtgatgaag
aaggtgaataaccaaccctctcctgcttgccctgccaaagcgaagtactcgggcatcgac
gccgcgcgttgggcagccgtctacggcgtcccgcttgcaccaaatggcgcgttcttccaa
gcaatgcgcgcagggcaagttgaaggcgcgatcttggcccgcgccgctcttgcggctcag
cagaccggctcgtttgaagtcgtccatccggccttatttcaagccgtatgggcgggtact
gacgacctcatcaccgcagaaggacgatctacctttctgaaaaatctcggcgtagacgaa
gacatctggcagttagcggatcgacctgccgttcgtgaccaactggccgccaacaatgaa
gaagccgctcgacgcggcgtatttggtgtgccgaccctcttctgcggcgacgaaatgttc
ttcggcaatgaccgactcgacttcgtgcgtgccgctctgcaaaaagccaaaggagcctcg
aaatga

DBGET integrated database retrieval system