KEGG   Pseudomonas aeruginosa M18: PAM18_1820
Entry
PAM18_1820        CDS       T01973                                 

Definition
(GenBank) NAD dependent epimerase/dehydratase family-like protein
  KO
K24310  UDP-4-keto-D-QuiNAc 4-reductase [EC:1.1.1.-]
Organism
paf  Pseudomonas aeruginosa M18
Pathway
paf00541  O-Antigen nucleotide sugar biosynthesis
paf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:paf00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PAM18_1820
Enzymes [BR:paf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PAM18_1820
SSDB
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind NAD_binding_4 Polysacc_synt_2 NAD_binding_10
Other DBs
NCBI-ProteinID: AEO74306
Position
1991559..1992377
AA seq 272 aa
MLLGELGSSVVWDAESAIDTVVHCAARVHVMSETASDPLVEFRKANVQGTLDLAREAVSR
GVRRFIFISSIKVNGEGTEPGRPYTADSPPNPVDPYGVSKREAEQALLDLAEETGLEVVI
IRPVLVYGPGVKANVQTMMRWLKRGVPLPLGAIHNRRSLVSLDNLVDLIITCIEHPAAVG
QVFLVSDGEDLSTTELLRRMGRALGAPARLLPVPASWIGAAAKVLNRQAFARRLCGSLQV
DIMKTRQVLGWTPPVGVDQALEKTARSFLDRQ
NT seq 819 nt   +upstreamnt  +downstreamnt
ttgcttctgggtgaactgggcagttctgttgtctgggatgcggagtcggccatcgatacg
gtggttcattgcgctgcccgcgtgcatgtcatgagcgagacggcctccgatccgctcgtc
gagttccgcaaggccaacgttcaggggacacttgatctggcccgggaggccgtatcccgg
ggagtgcggcgtttcatctttatcagctcgataaaggtcaatggcgagggaactgagccc
ggtcggccctatactgcggacagtccgcccaatcctgtcgatccctatggcgtttccaaa
cgggaagcggagcaagcgctattggatctggcggaagagaccggactggaggttgtgatc
atccgaccggtcctggtttatggtccaggggtcaaggccaacgtacagaccatgatgcgc
tggctgaagcgcggcgtgcccctccctctaggggctattcataatcggcgtagtctggtg
tcgctggataatcttgtcgacctcatcatcacctgcatcgagcatccggctgcggtcggg
caagttttcctcgtaagcgacggtgaggatctttccaccaccgagttgctgcggagaatg
ggacgcgccttgggcgctcccgctcgcctgctgcctgttcccgccagttggatcggtgca
gcggcgaaagttctgaacaggcaggcatttgctcgccgcctgtgcggctcattgcaagtc
gatatcatgaaaacccgccaagtgcttggctggactccgccggtaggggtggaccaggca
ttggagaaaaccgcccgctctttcctggatcgccaatga

DBGET integrated database retrieval system