KEGG   Pseudomonas aeruginosa LESB58: PLES_19161
Entry
PLES_19161        CDS       T00818                                 

Definition
(GenBank) ORF_13; similar to NAD dependent epimerase/dehydratase family
  KO
K24310  UDP-4-keto-D-QuiNAc 4-reductase [EC:1.1.1.-]
Organism
pag  Pseudomonas aeruginosa LESB58
Pathway
pag00541  O-Antigen nucleotide sugar biosynthesis
pag01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pag00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    PLES_19161
Enzymes [BR:pag01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     PLES_19161
SSDB
Motif
Pfam: Epimerase 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NAD_binding_10
Other DBs
NCBI-ProteinID: CAW26644
Position
2066543..2067271
AA seq 242 aa
MSETASDPLVEFRKANVQGTLDLAREAVSRGVRRFIFISSIKVNGEGTEPGRPYTADSPP
NPVDPYGVSKREAEQALLDLAEETGLEVVIIRPVLVYGPGVKANVQTMMRWLKRGVPLPL
GAIHNRRSLVSLDNLVDLIITCIEHPAAVGQVFLVSDGEDLSTTELLRRMGRALGAPARL
LPVPASWIGAAAKVLNRQAFARRLCGSLQVDIMKTRQVLGWTPPVGVDQALEKTARSFLD
RQ
NT seq 729 nt   +upstreamnt  +downstreamnt
atgagcgagacggcctccgatccgctcgtcgagttccgcaaggccaacgttcaggggaca
cttgatctggcccgggaggccgtatcccggggagtgcggcgtttcatctttatcagctcg
ataaaggtcaatggcgagggaactgagcccggtcggccctatactgcggacagtccgccc
aatcctgtcgatccctatggcgtttccaaacgggaagcggagcaagcgctattggatctg
gcggaagagaccggactggaggttgtgatcatccgaccggtcctggtttatggtccaggg
gtcaaggccaacgtacagaccatgatgcgctggctgaagcgcggcgtgcccctccctcta
ggggctattcataatcggcgtagtctggtgtcgctggataatcttgtcgacctcatcatc
acctgcatcgagcatccggctgcggtcgggcaagttttcctcgtaagcgacggtgaggat
ctttccaccaccgagttgctgcggagaatgggacgcgccttgggcgctcccgctcgcctg
ctgcctgttcccgccagttggatcggtgcagcggcgaaagttctgaacaggcaggcattt
gctcgccgcctgtgcggctcattgcaagtcgatatcatgaaaacccgccaagtgcttggc
tggactccgccggtaggggtggaccaggcattggagaaaaccgcccgctctttcctggat
cgccaatga

DBGET integrated database retrieval system