KEGG   Pantoea agglomerans C410P1: BEE12_22710
Entry
BEE12_22710       CDS       T04739                                 

Name
(GenBank) phosphoribosylglycinamide synthetase
  KO
K22114  dapdiamide synthase [EC:6.3.2.47]
Organism
pagc  Pantoea agglomerans C410P1
Pathway
pagc00997  Biosynthesis of various secondary metabolites - part 3
pagc01100  Metabolic pathways
pagc01110  Biosynthesis of secondary metabolites
Module
pagc_M00904  Dapdiamides biosynthesis, L-2,3-diaminopropanoate => dapdiamide A/B/C
Brite
KEGG Orthology (KO) [BR:pagc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    BEE12_22710
Enzymes [BR:pagc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.47  dapdiamide synthase
     BEE12_22710
SSDB
Motif
Pfam: ATP-grasp_4 GARS_A ATP-grasp_3 RimK LAL_C2 ATPgrasp_Ter GHMP_kinases_C CPSase_L_D2
Other DBs
NCBI-ProteinID: AOE42604
Position
unnamed2:173714..174988
AA seq 424 aa
MSILNNKEVIVIIDAWSGGKHLIPAFQALGYFCLHVQSTFLPEVFIADNQLAIARSDRHI
VHDGNIEALLSQLQPYTIKAILAGSEGAVGLADCLNDALELTFSNQFELSAARRNKYLMQ
EQLALKGVASINQQLAGHSDELNQWLAGHAHWPVVLKPIQSAGTDGVFICHDLAQALQAF
DTILAKKDFFGSPNREVLCQEFLAGEEFVVNGIACQGEYFFTELWQSKKQQRNGFPVYET
QYLHYQNDADFDVLTAYTAQVCQALGINNGAFHAEVMMTSGGPVLIEIGARVAGGADPYI
IEECLGHSQISKLAQAVLHPAKFLQECRRQHDFSGHRRAAYVYMISPSPGRVQVSPEEKF
IKIDGVISVNYHYAPGDIQKETCDLLSSPGVIIAIRDNPASLKQTIAEIRDVEADFYHLG
LIDE
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgtcgattttgaacaataaagaagtcatcgtaatcattgatgcctggtctggtggcaaa
cacttaatccctgcatttcaggcgctcggatatttttgtcttcacgtccaatctacattt
ctaccggaagtcttcatcgccgataatcaactggctatcgcccgcagtgataggcatatc
gtccatgatggcaatattgaagcactacttagtcagctgcagccttacacaatcaaggct
attttggctggtagcgaaggcgcagttggactagccgattgcctgaacgatgccttggaa
ctcactttcagtaatcagttcgaactatctgcagcacgacgtaataagtacctgatgcag
gaacagctcgctttaaagggcgtggcttccatcaatcagcagctggctgggcactcagat
gaattaaaccaatggctggcaggtcacgctcactggccggtggttctgaagccaatacaa
agcgctggtaccgatggggtatttatttgtcatgacctggcacaggcccttcaggcattt
gacaccattctggccaaaaaggatttttttggaagtcctaaccgggaagtattgtgtcag
gagtttttggcaggagaggagtttgtagttaacggcattgcctgccagggggagtacttt
tttactgaattatggcaatccaaaaaacaacagcgcaacggtttcccggtatatgaaacg
cagtacctgcattatcagaatgatgccgactttgatgtgctgaccgcctataccgcgcag
gtgtgccaagcacttggcattaataatggggcttttcatgccgaagtaatgatgacttcg
ggggggcctgtgttgattgaaattggggcccgggttgcaggcggcgcagacccttatatt
atcgaagagtgtctggggcattcacaaataagcaaattagcacaggctgtgctacatccg
gctaagttcttgcaggagtgtagacggcagcatgacttttcaggccatcgacgtgccgca
tatgtctacatgatttcgccttccccgggtcgtgtgcaagtctcaccggaagaaaaattt
atcaaaatcgacggcgttatcagcgtcaattatcactacgcccccggagatatacagaaa
gagacctgtgatctattgagttctccgggagtaatcattgctatcagggataaccctgcc
tcgctaaaacagacgattgcagaaatccgcgatgtcgaagcggatttttatcacttgggc
ctaattgatgaataa

DBGET integrated database retrieval system