KEGG   Pyrobaculum aerophilum: PAE1203
Entry
PAE1203           CDS       T00073                                 
Name
(GenBank) spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
pai  Pyrobaculum aerophilum
Pathway
pai00270  Cysteine and methionine metabolism
pai00330  Arginine and proline metabolism
pai00480  Glutathione metabolism
pai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PAE1203
   00330 Arginine and proline metabolism
    PAE1203
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    PAE1203
Enzymes [BR:pai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     PAE1203
SSDB
Motif
Pfam: Spermine_synth Spermine_synt_N Methyltransf_12 Methyltransf_25 Cons_hypoth95 Methyltransf_11
Other DBs
NCBI-ProteinID: AAL63322
UniProt: Q8ZXM4
Position
704430..705305
AA seq 291 aa
MSKVPGPIVLMEPLSGKTSLIIKINAIHVSKRSKYQGILIVDTDDYGRTLVLDDYIQSSY
YDEIYYHESLVHPAVTTHPRPSDVLILGGGEGATLREVLKHNTVKRAVMVDIDGDVVELS
KKYLPQMHQGAFDDPRSEVRIEDGFVYVENALKRGEKFDVVIMDLTDPYSSDIAKQLYTP
EFFGKVKRLLREDGIVVTQAGNSFYFPEAYDYVLQGVKGNFPIIAEYSVWIPSFGYAVNF
VLGSLKHDPHSLSAEEVDKRLSERGVRAEFYSGKTHIALMNMPVIKKILRV
NT seq 876 nt   +upstreamnt  +downstreamnt
atgtcaaaggtgccgggtccaatagtgctaatggagccgcttagcgggaagacgtcgctg
ataatcaagataaacgcaatacacgtttcgaagcgttctaaatatcaagggattttaata
gtagatactgatgattacggcaggaccttggtattagacgactatattcaatcctcttat
tacgacgagatttactatcacgaatcgttagtgcaccccgcagtgaccactcacccgcgt
ccaagcgacgtcttaatactgggagggggcgagggggctactctccgcgaggtgctcaaa
cacaacactgtgaaaagggctgttatggtggatattgacggcgatgtggtggagctgtca
aaaaaatacctcccgcaaatgcatcaaggcgcatttgacgacccccgtagcgaagtgcgt
attgaagacggttttgtctacgtggaaaacgccttgaaacgcggcgagaaattcgacgtg
gtgataatggacctcacagatccctacagttcagacattgcaaaacagctttacacgccg
gagttctttggcaaagtaaagaggttgctacgagaagacggaattgtagtgacgcaggca
ggcaatagtttctacttcccagaggcatatgactatgtcctacagggggtgaagggcaat
ttcccaataattgctgagtacagcgtgtggatcccctccttcggatacgcggtgaatttc
gtactgggctcgctcaaacacgacccccattcgctaagcgccgaggaagtggacaagagg
ctgtctgagaggggagtgagagcggagttttacagcggcaagacgcacatagcattaatg
aacatgcccgtcattaaaaagatactccgtgtctga

DBGET integrated database retrieval system