KEGG   Pseudomonas alkylphenolica: PSAKL28_31420
Entry
PSAKL28_31420     CDS       T03238                                 
Name
(GenBank) p-hydroxybenzaldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
palk  Pseudomonas alkylphenolica
Pathway
palk00623  Toluene degradation
palk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:palk00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    PSAKL28_31420
Enzymes [BR:palk01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     PSAKL28_31420
SSDB
Motif
Pfam: Aldedh DUF1487 LuxC
Other DBs
NCBI-ProteinID: AIL62312
UniProt: A0A077FA43
Position
complement(3460309..3461784)
AA seq 491 aa
MSQRLAAYENMSLQLIAGEWRVGKAGRDLDVLDPFTQEKLLQIPLANREDLDEAYRSARQ
AQVAWAACGPSERAQVMLNAVRIFDERRDEIIDWIIRESGSTRIKAQIEWGAARAITQES
ASLPSRVHGRILASDVPGKESRVYREPLGVIGIISPWNFPLHLTARSLAPALALGNACVI
KPASDTPVTGGLLLAHIFEEAGLPKGVLSVVVGSGSEIGDAFVEHEVPGFISFTGSTQVG
RNIGRIAAGGEHLKHVALELGGNSPFVVLADADLDQAVNAAVVGKFLHQGQICMAINRII
VEDSVYDEFVNRYAERVKSLPYGDPSKPETVVGPVINAKQLAGLQDKIATAKSEGARVMV
EGEAQGNVLPPHVFADVTADMEIAREEIFGPLVGIQRARDEAHALELANSSEYGLSSAVF
TSSLERGVKFARGIRAGMTHINDIPVNDEPNAPFGGEKNSGLGRFNGDWAIEEFTTDHWI
TVQHAPRRYPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtctcaacgccttgctgcttatgagaacatgagtctgcaactgatcgccggtgaatgg
cgtgttggtaaagccggtcgggatctcgatgtcctcgatccttttacccaggagaaactg
ctgcagattcccttggccaaccgtgaagatctcgacgaggcctaccgcagcgcgcgccag
gcacaagtagcctgggcggcgtgcggcccttccgagcgcgctcaggtgatgctcaacgcg
gtacgtatttttgacgagcgccgcgacgagatcatcgactggatcatccgtgagtcgggc
agcacccgtatcaaggcacagatcgaatggggcgccgcgcgcgccatcactcaggagtcc
gccagcctgccgagccgcgttcacggccgcatcctggcctccgatgtgcctggcaaggaa
agtcgcgtctaccgtgagccgctgggtgtgatcggtatcatcagcccctggaacttcccg
ctgcacctgactgctcgctccctggctccggctctggcgctgggcaacgcgtgcgtgatc
aagccggccagcgatacgccggttaccggtggcctgctgctggcgcacattttcgaagaa
gcgggcctgcccaagggcgtgctcagcgtcgtggtcggttccggtagcgaaattggcgac
gccttcgtcgagcacgaagtgccgggcttcatttccttcactggctcgacccaggttggc
cgcaatatcggtcgtattgccgccggtggcgagcacctcaagcacgtggcactggagctg
ggcggcaacagccccttcgtggtgctggcggacgccgacctcgatcaggcggtaaatgcc
gcggtagtgggcaagttcctgcaccaggggcagatctgcatggcgatcaaccgcatcatc
gttgaagactctgtctacgatgagttcgtcaatcgctacgccgaacgcgtcaagtcgctg
ccctatggcgacccgagcaagcctgaaaccgtggtcggcccggtaatcaatgccaagcaa
ctggccggtctgcaagacaaaatcgcaaccgccaaatccgaaggcgctcgcgtcatggtg
gaaggcgaggcgcagggcaacgtactgccgcctcatgtgttcgccgatgtgacggccgat
atggaaatcgcacgcgaagaaatcttcggcccgctggtcggcattcagcgcgcccgcgac
gaggcgcacgcccttgagctggccaacagcagcgagtacggcctgtcgagcgccgtgttc
acctcgagccttgaacgtggcgtgaagttcgcccggggcatccgcgccggcatgactcac
atcaacgacattccggtcaacgatgagcccaacgcgccgtttggcggtgagaagaactcg
ggcctgggccgcttcaacggcgactgggcgatcgaggagttcaccaccgatcactggatt
accgtgcagcacgccccgcgccgctatccgttctga

DBGET integrated database retrieval system