KEGG   Podospora anserina: PODANSg2382
Entry
PODANSg2382       CDS       T01048                                 

Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
pan  Podospora anserina
Pathway
pan03440  Homologous recombination
pan03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:pan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    PODANSg2382
   03450 Non-homologous end-joining
    PODANSg2382
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pan03400]
    PODANSg2382
DNA repair and recombination proteins [BR:pan03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     PODANSg2382
   NHEJ (non-homologous end-joining)
    MRX complex
     PODANSg2382
SSDB
Motif
Pfam: NIBRIN_BRCT_II FHA RTT107_BRCT_5 Yop-YscD_cpl BRCT
Other DBs
NCBI-GeneID: 6189548
NCBI-ProteinID: XP_001905358
UniProt: B2AMS1
Position
5
AA seq 853 aa
MWLLESDLFEAYLQLTRKPGKKLWLRPGKLYLFGRTVSEAGQLVISDKTISRKHITIKVE
PVPEGGGRNITSRSQITIEDLDSKKGTTVNDVQIRGQKKVLTETVNTVKLGMCQKLLRIQ
WYPVVLSFSFTSKELRADPWTKLRDDLEQLDIKYSAEYEETTTHVVSKKRNTSKGLQALI
NGKLIVTESFINTIINAATTPADAEEGSSSALEQDFDHHWPNALDHLPPRGEETGERPST
AYAPDERRQEVFEGYTFVFYEKKQFENLLSPITSGRGKAVLNAVTPGQTDVDDFVRFVKG
VAGEKGLGSFEDGSEGKGVVVVRYIPKDENYEWYAQFLTEFAQRLDHRPIDQREFIEAIL
DCDASMLRRPLEEASQSEPAMSRPEAHTEPGVRMEIDQPSTEPTAPQQREVEREPSPQPP
PRRVRTRRGVSRFKGFDIEDDNPEPTQEIGPVQPNLPELSQPAVEASQDGLFVSQYQDPL
DRPEEETAPESRPLPRATRKRPLSPLPEHDESALLANIAPTAAAAKRRRIQAGEPPVPPP
PEPEPPVKDEDNDEMVIEFPQDKSEKGRGTKGKGKKTAGGDDILELARKQREEAEARAAA
ERRALTELGDDEIDYAEIRRLQLETVQECEVRFPEPWTGGAGTSRTREQDIADGRWDPKW
NGRRNYKQFRKQGAATGRQASRTVIPLEEVRPKSNGIGDEYWLENDSNSRQKNDATSQRQ
SQTQQQTSNPTPEKAKAPLRENILTIDSSDEDEDDVDVMDEDRAAPEPTPEPARSRAAKA
AERANARKGQSQAQSTQTQSQSSNKRAAPPLNASPSSSREAKKPRRGGFMAASRDESDDD
SDDELKFRFGRRK
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgtggctgctggagagcgatcttttcgaagcgtacctgcagctaacgcgcaaaccaggc
aagaagctctggctgcggcctggaaagctctacctcttcggccgcacggtatctgaggct
ggtcagctcgttatctctgacaagaccatttcgcgtaaacacatcaccatcaaggttgag
cctgtcccggaaggcggcggccgcaacattacctccagatcccagatcaccattgaagat
ctcgattcaaaaaagggaaccaccgtaaacgatgtccagatacgcggccagaagaaagtc
ctcaccgagactgtgaatacagtcaagctaggaatgtgccagaagcttctgcgcattcag
tggtaccccgttgtgctgagcttctccttcactagcaaggagttacgtgcagacccgtgg
acaaagcttcgcgatgatctcgaacaattggatataaaatactcggctgaatacgaagaa
accaccacccacgtcgtgtcaaagaagcgcaacacgtcgaaggggcttcaagctctcatt
aatggcaaacttattgtcaccgagagcttcatcaacaccatcatcaatgcagcaacaaca
ccagccgatgccgaggaaggctcgtcgagcgcgttggaacaagactttgatcaccattgg
cccaatgctctcgaccacttgccgccacgaggtgaagagaccggagaacgacccagcaca
gcctacgctccggatgaacggcgacaggaggtgtttgaagggtacacgtttgttttttac
gagaagaaacagtttgaaaacctcctctctcccatcacttctgggaggggtaaagcggtg
ttgaatgcagtgacgccaggacaaacggacgtggatgatttcgtccgtttcgtcaaaggc
gtggctggtgaaaaggggcttgggtcttttgaggatggcagcgaggggaagggagtggtg
gttgttcgatacatcccgaaagatgaaaactacgaatggtatgcgcagtttctcacagaa
tttgctcagcggctcgaccatcgaccaatcgaccagcgcgaatttattgaggcgatcctg
gactgcgatgcttccatgttgcgacgccccttggaagaggctagtcaatccgaaccggca
atgtcacgtcctgaagctcacacagaaccaggtgttcgcatggaaatagatcagccatcg
accgagccgacagccccccagcaaagagaggtggagagagaaccctcgccacaaccgcct
cctcgaagagtgcggactcgaagaggtgtaagcagattcaaaggctttgatatcgaggac
gacaaccccgagccgactcaagagataggccccgttcaacctaaccttcccgaactaagc
cagcccgcagtcgaagcgtcacaggatggtctgtttgtttcgcagtaccaggaccctctt
gatcgtccagaggaagagactgcacccgagtcgcgccctctgcctcgagctacgcgcaaa
cgcccactctcacccttgccagaacatgatgaatcggcattactagccaacattgccccc
acagccgcggcagccaaacgcaggcgtattcaggcaggagagccgcctgtgcccccacca
ccggaaccggagcctccagttaaggacgaggacaatgacgagatggtgattgaatttccc
caagacaaaagtgagaaggggcgaggtacgaaagggaaaggcaagaaaacagcaggcggt
gacgatatcttggagctggcgcgcaagcagcgcgaagaggccgaagccagagcagccgcg
gaacgtcgagcactgaccgagttgggcgatgatgagattgattatgcggaaattcgcagg
ctgcaacttgaaacggtccaggaatgtgaggttcgcttccctgagccatggacaggggga
gctggtaccagtcgtacgcgtgagcaggacattgccgacggtcgttgggatcccaaatgg
aatggtcgtaggaattacaagcagttccgaaagcaaggtgcagccactggacggcaagca
tcacgaacagtaattcccctagaagaggttcggccaaagagcaatggtatcggtgacgag
tattggctcgagaacgactccaacagtcgccaaaagaacgatgccaccagccaacgtcaa
tctcaaacgcagcagcaaaccagcaatcccacccccgagaaagccaaggcccctctcagg
gagaacattctcaccatcgacagcagtgatgaggacgaagatgatgtggatgttatggac
gaggaccgagcagcaccagagccaacacccgagccagcaaggtcgagggcggccaaggca
gcggagcgggccaatgctcggaagggccagtcacaggcacagagcacgcaaacgcagtcg
cagagcagcaacaagcgagcagcaccaccgctgaatgcctcacctagtagctcgagggaa
gcgaagaagccgcgtcggggagggttcatggctgccagtagagacgaaagcgacgacgac
agcgatgatgagttgaagttccggtttggcaggcggaagtga

DBGET integrated database retrieval system