KEGG   Papio anubis (olive baboon): 101026757
Entry
101026757         CDS       T07474                                 

Name
(RefSeq) cytochrome P450 3A8 isoform X1
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
panu  Papio anubis (olive baboon)
Pathway
panu00140  Steroid hormone biosynthesis
panu00591  Linoleic acid metabolism
panu00830  Retinol metabolism
panu00980  Metabolism of xenobiotics by cytochrome P450
panu00982  Drug metabolism - cytochrome P450
panu00983  Drug metabolism - other enzymes
panu01100  Metabolic pathways
panu04976  Bile secretion
panu05204  Chemical carcinogenesis - DNA adducts
panu05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:panu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101026757
   00591 Linoleic acid metabolism
    101026757
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101026757
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101026757
   00982 Drug metabolism - cytochrome P450
    101026757
   00983 Drug metabolism - other enzymes
    101026757
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    101026757
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    101026757
   05207 Chemical carcinogenesis - receptor activation
    101026757
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:panu00199]
    101026757
Enzymes [BR:panu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     101026757
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     101026757
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     101026757
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     101026757
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     101026757
    1.14.14.-  
     101026757
Cytochrome P450 [BR:panu00199]
 Cytochrome P450, animal type
  CYP3 family
   101026757
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 101026757
NCBI-ProteinID: XP_003895805
Ensembl: ENSPANG00000017641
VGNC: 81858
Position
4
AA seq 503 aa
MDLIPDLAVETWLLLAVTLVLLYLYGTHSHGLFKKLGIPGPTPLPLLGNVLSYRKGFWTF
DMECYKKYGKVWGFYDGRQPVLAITDPNMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI
AEDEEWKRIRSLLSPTFTSGKLKEMVPIIAKYGDVLVRNLRRETETGKPVTLKDVFGAYS
MDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSITIFPFLIPILEVLNISI
FPREVTSFLRKSVKRIKESRLKDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI
IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV
NETLRLFPIAMRLERVCKKDVEINGIFIPKGVVVMIPTYALHHDSKYWTEPEKFLPERFS
KKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLRLG
GLLQTEKPIVLKIESRDGTVSGA
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggatctcatcccagacttggctgtggaaacctggcttctcttggctgtcaccctggtg
ctcctctatttatatggaacccattcacatggactttttaagaagcttggaattccaggg
cccacacctttgcctttattgggaaatgttttgtcctaccgtaagggcttttggacgttt
gatatggaatgttataaaaagtatggaaaagtgtggggcttttatgatggtcgacagcct
gtgctggctatcacagatcccaacatgatcaaaacagtgctagtgaaagaatgttattct
gtcttcacaaaccggaggccttttggtccagtgggatttatgaaaagtgccatctctata
gctgaggatgaagaatggaagagaatacgatcattgctctctccaactttcaccagcgga
aaactcaaggagatggtccctatcattgccaagtatggagatgtgttggtgagaaatctg
aggcgtgaaacagagacaggcaagcctgtcaccttgaaagatgtctttggggcctacagc
atggacgtgatcactagcacatcatttggagtgaatatcgactctctcaacaatccacaa
gacccctttgtggaaaacaccaagaagcttttaagatttgatttcttagatccattcttt
ctctcaataacaatcttcccatttctcatcccaattcttgaagtattaaatatctctatt
tttccaagagaagttacaagttttttaagaaaatctgtaaaaaggataaaagaaagtcgc
ctcaaagatacacaaaagcaccgagtggatttccttcagctgatgattgactctcagaat
tcgaaagaaactgagtcccacaaagctctgtctgatctggagctcgtggcccaatcaatt
atcttcatttttgctggctatgaaaccaccagcagtgttctttccttcattatgtatgaa
ctggccactcaccctgatgtccagcagaaactgcaggaggaaattgatgcagttttaccc
aataaggcaccacccacctatgatactgtgctacagatggagtatctcgacatggtggtg
aacgaaacgctcagattatttccaattgctatgagacttgagagggtctgcaaaaaagat
gttgaaatcaatgggatattcatacccaaaggggtggtggtgatgattccaacctatgct
cttcatcatgactcaaagtactggacagagcctgagaagttcctccctgaaaggttcagc
aagaagaacaaggacaacatagatccttacatatacacgccctttggaagtggacccaga
aactgcattggcatgaggtttgctctcatgaacatgaaacttgctctaatcagagtcctt
cagaacttctccttcaaaccttgtaaagaaacacagatcccgctgaaattacgcttagga
ggacttcttcaaacagaaaaacccattgttctaaagattgagtcaagggatgggaccgta
agtggagcctga

DBGET integrated database retrieval system