Pantoea ananatis PA13: PAGR_g1136 Help Entry PAGR_g1136        CDS       T01970                                  Name (GenBank) holo-ACP synthase AcpS   KO K00997   holo-[acyl-carrier protein] synthase [EC:2.7.8.7] Organism paq  Pantoea ananatis PA13 Pathway paq00074   Mycolic acid biosynthesis paq00770   Pantothenate and CoA biosynthesis paq01100   Metabolic pathways paq01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:paq00001]  09100 Metabolism   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     PAGR_g1136   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     PAGR_g1136 Enzymes [BR:paq01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.8  Transferases for other substituted phosphate groups     2.7.8.7  holo-[acyl-carrier-protein] synthase      PAGR_g1136 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACPS Tecti-min-caps Motif Other DBs NCBI-ProteinID:  AER31662 Position 1213798..1214178 Genome browser AA seq 126 aa AA seqDB search MAILGLGSDIVEIERIADVISRSGDRLARRVLSEAEWQQYQQHRQPVRFLAKRFAVKEAA AKAFGTGIRGGLAFNQFEVYNDALGKPLLRFFDHAAEVAQRLGVQHVHVTLADERHYACA TVIIES NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggctatcctgggactgggcagcgatatcgtcgaaatagaacgcattgccgatgtgatt tcacgttcaggcgatcgtcttgcgcggcgtgtcctgagcgaggccgagtggcagcaatat caacagcaccgtcagccggttcgtttcctggccaaacgttttgcggttaaagaggcggcg gcaaaagcctttggtaccggcattcggggcgggctggcttttaaccagttcgaagtttat aacgacgcgctgggtaaaccgctgctgcgtttcttcgatcatgccgccgaggtggcgcaa cgtcttggcgtgcagcatgtgcatgtcacgctggcagatgagcgtcactatgcctgcgca acggtgatcatcgaaagttaa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (2) Pfam (2) All databases (4) Download RDF

DBGET integrated database retrieval system