KEGG   Paraburkholderia aromaticivorans: CJU94_38630
Entry
CJU94_38630       CDS       T05169                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
parb  Paraburkholderia aromaticivorans
Pathway
parb00626  Naphthalene degradation
parb01100  Metabolic pathways
parb01120  Microbial metabolism in diverse environments
parb01220  Degradation of aromatic compounds
Module
parb_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:parb00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CJU94_38630
Enzymes [BR:parb01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     CJU94_38630
SSDB
Motif
Pfam: DSBA Thioredoxin_5
Other DBs
NCBI-ProteinID: ASW04110
UniProt: A0A248W0H4
Position
pBN2:complement(469554..470129)
AA seq 191 aa
MVVDFYFDFLSPFSYLANHRLSKLAQDHSFSVRYHTIDLARVKTAIGNIGPSNRDLKVKL
DYLKVDLQRWAELYGIPLVFPANYNSRRMNTGLYYPGAVAQAADYVDVVFHAVWGEGMAP
DAESLPALASETLGWDRAAFGAFLSSDAATKAYDEQTQAAIERKVFGVPTMFLGDEMWWG
NDRLFMLESAL
NT seq 576 nt   +upstreamnt  +downstreamnt
gtggttgtcgatttctatttcgattttttgagtcctttctcgtacttggccaaccaccgc
ttgtcgaagctcgcgcaagaccatagcttttccgttcgatatcacacaatcgatttggcg
cgggtcaaaacagccatcggaaacatcggtccctccaaccgcgatctgaaagtcaaattg
gactatttgaaggtggacttgcaacggtgggccgaactgtacggaattcccttagtcttc
ccagctaactacaacagccggcggatgaacacagggctgtattacccgggtgctgtggcg
caggctgctgactacgtggatgtggtgtttcatgcggtttggggagaaggcatggctcca
gatgcggaaagcctgcctgccctggcatccgagacactgggctgggatcgagctgccttt
ggggcgttcctcagcagcgacgccgccaccaaggcgtatgacgagcagacacaggccgcc
atagaacgcaaagtgttcggtgtgccgacgatgtttttgggcgatgaaatgtggtgggga
aacgaccgcctgttcatgctcgagagcgcactgtaa

DBGET integrated database retrieval system