KEGG   Paralcaligenes sp. KSB-10: LSG25_00455
Entry
LSG25_00455       CDS       T07761                                 
Name
(GenBank) 3-isopropylmalate dehydratase
  KO
K17749  3-benzylmalate isomerase [EC:4.2.1.-]
Organism
park  Paralcaligenes sp. KSB-10
Pathway
park00400  Phenylalanine, tyrosine and tryptophan biosynthesis
park01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:park00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LSG25_00455
Enzymes [BR:park01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     LSG25_00455
SSDB
Motif
Pfam: Aconitase Aconitase_C
Other DBs
NCBI-ProteinID: UHL64427
Position
complement(96334..98337)
AA seq 667 aa
MTTASFPKPTPFGRILFLSSRPGAIAAQLDGCKLRLSDALPLRDDISTDEITPMPVLAHY
DEKLGRYPYTGVQANNETPIGPDAILNGGFEVTVSGKRYGKGSSREHSPAAEKLAGIRLV
IAESFERLYRQNADNIGLITSTDFGLIERIQNGEAISLEELVKDREALAANILACGGLLH
FGRKHMEHVVSVTPSSSKKPQTLFEKIVARHMLETEHARFTTTPGAGIFIRADWRFIHEY
YTGMCAHMLHSTFGRPVILRDKESIVAFEDHTSYINTSVAHVSRGLVPNILRMCEAHRDF
VADYNLRSHRTLSESEVAHSDGGNVAGISHAMMSEHYALPGQVVVGTDSHTPHSGALGCA
AFGVGTTDMANAFVTGAVRLTVPESLLIRLDGTLPAGITAKDIVLELLARPEIRSGLGIG
KVFEFAGPAIESLSIDERATLTNMTAELGGLTGIVAPDQETIRFLRERRGVEFPIEPWMH
SDPDAHYAASLHIDCEQISPMIARPGDPGNGLSIRDLREHVAIDIAYGGSCTAGKRADFD
HYHAVLAWGLEHGLRIPPTVTLYLQYGTTAVRDYCIGRGYDRVFSAMGARMLEPSCGACA
NCGPGSSSRADQVTVSAINRNFTGRSGPGKVWLASPPTVAASALAGELISFEELQKRAAT
RNAAPRP
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgacgaccgcaagctttccaaaaccgacgccatttgggcgcatcctgttcctgtcctcc
aggcctggcgctattgcggcgcagctcgatggatgcaagttgcgcctgtccgacgccctg
ccactgcgcgacgatatttccaccgacgaaatcacgcccatgcccgttctggcgcattac
gacgagaaactcggacgctacccttataccggcgtacaggcaaacaacgagacgcccatt
ggtccagacgccattctgaatggcggcttcgaggtgaccgtgagcggcaagcgctatggc
aagggctcctcgcgcgaacatagtcctgccgcggaaaagctggcgggcatcaggcttgtg
atcgccgaaagtttcgaaaggctttaccggcagaatgccgacaacatcggattgatcacg
tcgaccgatttcgggctgatcgaacgcatccagaacggcgaagccatttcgctcgaagaa
ctggtcaaagatcgcgaagcgctggccgccaatatcctggcctgcggcggcttgctgcat
ttcggccgcaagcacatggaacacgtcgtcagcgttacgccatcatccagcaaaaaaccg
caaaccctgttcgagaaaatcgtcgcacgccatatgcttgaaaccgaacatgccaggttc
acgactacgcccggcgccggtatttttatacgagccgactggcgtttcatacacgagtac
tacaccggcatgtgcgcccacatgctgcactccacgttcggcaggccggtcattctgcga
gacaaagaatcgattgttgccttcgaagaccacacctcgtacataaataccagcgttgcg
cacgtgtcgcgcggcctggtgccgaacattctgcgcatgtgcgaggctcatcgcgatttt
gtcgccgactacaatttacgatcgcaccgcaccctgagcgaatccgaagtcgctcatagc
gacggcggcaatgtcgccggcatttcgcatgccatgatgagcgaacactatgccctaccc
ggccaggtcgtggtgggcaccgactctcataccccgcacagcggcgcgctgggctgcgcg
gcattcggagtaggcaccacggacatggccaatgcctttgtgaccggcgcggttcgcctg
accgtgcccgaatccctgctgatcaggctcgacggcacgcttcctgccggcattaccgcg
aaagacatagtcctggaactgctggcacggccggaaatccgcagcggcctgggtataggc
aaggtctttgaatttgcgggaccggcaatcgaatcattgtcgatcgacgaacgcgccaca
ctcaccaatatgacggcagaactgggcggcctgactggaatcgtggctcccgatcaggaa
acgattcgttttctgcgcgagcgccggggcgttgaatttccgatcgaaccctggatgcac
agcgacccagacgcccattacgctgctagcctgcatatcgattgcgaacagatttcaccc
atgattgcccgcccgggcgacccgggcaacggcctttcgatcagggacctgcgggaacat
gttgcgatcgatattgcctatggaggctcatgcaccgcaggcaagcgtgccgacttcgac
cattaccatgccgtcctggcctgggggctggaacacggcttgcgcatacccccgacagtg
acactttacctgcaatacggcaccaccgctgtccgggattactgcatagggcgcggctat
gatcgcgtgttcagcgccatgggagcccgcatgctggaaccgtcttgcggcgcctgcgcc
aattgcggccccggctcgtcgagccgtgccgatcaggttacggtcagtgccataaaccga
aattttaccggccgatcgggccccggcaaagtctggctggccagccctcctaccgtggca
gccagtgccttggctggagagctgatatcgtttgaagaattgcaaaagcgggccgccacc
cgcaacgcagcccccaggccttag

DBGET integrated database retrieval system