KEGG   Pseudomonas asgharzadehiana: KSS96_11045
Entry
KSS96_11045       CDS       T07697                                 

Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K19700  3-succinoylsemialdehyde-pyridine dehydrogenase [EC:1.2.1.83]
Organism
pasg  Pseudomonas asgharzadehiana
Pathway
pasg00760  Nicotinate and nicotinamide metabolism
pasg01100  Metabolic pathways
pasg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pasg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KSS96_11045
Enzymes [BR:pasg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.83  3-succinoylsemialdehyde-pyridine dehydrogenase
     KSS96_11045
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: QXH69422
Position
2361182..2362624
AA seq 480 aa
MFLQSKNRNRFFISGAWVSPQGQQQYHNVINPADGQVSGSVSFGSAADVDLAIQAAFDAF
PEYSTTTVEFRIALLERICAVYERRSDELAEAITIEMGAPFHQLSRPLQASVGLWHFQAA
LAALKDFSFETQRGSTLITKEPIGVCSLITPWNWPMNQTVCKVAPALAVGCTMVLKPSQN
APYSALILAEIMEEAGVPAGVFNLVNGEGRKLGQQLASHPLVDMVSLTGSTQAGASLTIA
GADTVKRMSLELGGKSANIILPDADLEQAVRHGVLHMMSNSGQSCTAPSRMLVPHALLEK
VEEIITTVCSEIKVGDPMDPETTMGPMANERQYNLVRELIQVGIDEGAKLLVGGIENPVK
DNAGFYISPTVFTQVDNTMRIAREEIFGPVLVVIGYDSEEEAISIANDSIYGLSGYVHSS
SPARAKAVAKRMRTGMVHLCGAPIDINAPFGGYKQSGNGREWGASGLDEFLETKSIMGAL
NT seq 1443 nt   +upstreamnt  +downstreamnt
atgtttctgcaaagtaaaaatcgtaatagattttttatcagcggtgcgtgggttagtcca
cagggccagcagcagtatcacaatgttatcaaccctgccgatggccaggtttctgggtcg
gtttcatttggttcagcggctgatgtggatttagctatacaggcagcctttgacgcgttc
cctgagtactccactaccactgtggagtttcgtatagcgctcctggagcgaatctgtgca
gtttatgagcggcgttcagatgagctagccgaggcgattaccattgagatgggggcgcct
tttcatcaattgtcccgcccgctccaggcctcggttgggctctggcattttcaagcggca
ttggcagcacttaaagatttcagtttcgaaactcaacgtgggtcgacgctcatcaccaaa
gaacctataggcgtgtgctctttgattacgccttggaactggccgatgaatcagactgta
tgcaaagtcgcaccagcgctggctgtgggctgcactatggtgctgaagccaagtcagaat
gctccctattcggctctgatattagccgaaatcatggaggaggcgggcgttcccgccggt
gtgttcaatttggtaaacggtgagggacgaaaactgggacaacaattagcatcacatcca
ctggtcgatatggtgtcattaacaggatccacccaagccggagcgagtcttaccattgcc
ggcgcagataccgtaaaaagaatgtcactagagttgggcggtaaatctgcaaacattatt
ctgcctgacgctgatttagagcaagcagttagacacggagttctacacatgatgtctaac
tccggtcagtcgtgtacagctccgtctcgaatgcttgtccctcatgctctacttgagaag
gtcgaggaaattatcacgacagtgtgctcggagatcaaagtgggtgatccgatggaccct
gaaaccacgatgggtccaatggcgaacgagcgccagtacaatttagtacgggagttgatc
caggtgggtatcgatgagggcgcaaagctcttagtcggagggatcgaaaatccagtaaag
gacaatgcgggcttttacatatctccaaccgtatttactcaggtggacaatacaatgcga
attgcacgggaggaaatttttggccctgtgttagtcgtcattggttatgatagcgaagag
gaagctatttctatcgctaatgattcgatatatggtctttctggttatgttcattcatcg
agtccagcgcgtgctaaggctgttgcgaaacgcatgcgcacggggatggttcatctatgc
ggcgcgccgattgatattaatgctccttttggtggttataaacaatcggggaatgggcgg
gagtggggcgcctcgggtttagatgagtttttagaaacaaagtcgataatgggcgcacta
tag

DBGET integrated database retrieval system