KEGG   Pseudomonas asgharzadehiana: KSS96_11230
Entry
KSS96_11230       CDS       T07697                                 
Name
(GenBank) aldehyde dehydrogenase family protein
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
pasg  Pseudomonas asgharzadehiana
Pathway
pasg00623  Toluene degradation
pasg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pasg00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    KSS96_11230
Enzymes [BR:pasg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     KSS96_11230
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: QXH69453
Position
complement(2405314..2406786)
AA seq 490 aa
MNNHQPYSDLNLQLIGGVWREGRTGRSMTVSDPFTQQTLLEIPLANKEDLNEAYARAKTA
QPAWAAMGPSARAGVLLRAAQIFDKRHDELVDWIISESGSTRIKAEIEWASAKAITLEAA
SFPSRIHGRIVESDVPNKESRVYRRPLGVVGVISPWNFPFHLTQRSLAPALALGNAVVVK
PASDTPVTGGLLLARIFEEAGLPEGVLSVVVGAGSEIGDDFVLHPIPSFISFTGSTPIGQ
NIARQAGSGDYLKHVALELGGNNPFVVLADADLQQAVHAAVVGKFLHQGQICMAINRIIV
EEPIYDSFVSLFIQRVSHLIIGDPKNSATSVGPVINRKQFDGLVRKIEQAKSEGATLAYA
GESAGLVFAPHVFTEVTSDMELAYEEIFGPIAGIMRARDADHALELANATRFGLSAAVFS
GDIDRGVHFARQIHSGMAHVNDMPVADAPNVPFGGEKNSGLGRFNGDWAIDEFTTTQWVS
VQRKPRHYPF
NT seq 1473 nt   +upstreamnt  +downstreamnt
gtgaacaatcatcaaccttatagcgacctcaatctgcagctgataggaggagtttggcgg
gaaggtcggacaggacgatctatgactgttagcgatcctttcacccagcagactctgctc
gaaatccctttggccaataaggaagacttgaacgaagcttatgcaagagctaaaacagcc
cagcctgcttgggcggccatggggccgtccgcgcgagccggagtgctgctaagagcagct
cagatttttgataagcgccacgacgaattggtcgattggatcatttcggaatcaggaagt
acgcgcataaaagccgagattgaatgggcgtcagcgaaagctatcactttggaagctgct
tcctttccaagccggattcatggtcgcatcgtggagtccgatgtgccgaacaaggaaagc
cgagtatatcgacgcccgctcggcgtagttggcgtgattagcccatggaactttccattc
catctcacccagcgatcgctcgccccggcattggcactcggtaacgccgtagttgtgaaa
cctgccagcgatactccagtaaccggaggcttgctgcttgcacgcatctttgaagaggcc
gggttgccagagggtgtgctcagtgtagtggtaggggcaggctcggagattggagacgac
ttcgtgctacatccaataccgagctttatatccttcaccgggtccacgccgattggccag
aatatagcccgccaggcaggcagcggcgactacttgaaacatgtcgcgctggaactaggc
ggtaacaacccctttgtggtgctcgctgatgcggatctccagcaagcagttcatgcggct
gttgttggcaaatttctgcaccagggtcaaatctgcatggccatcaataggattatcgtg
gaggagccgatttacgactcattcgtttccctgtttatccagcgcgtgagccatttgata
atcggtgatcctaaaaattcggcaacctcggttgggcccgtcatcaaccggaaacagttt
gacggattggtacgcaagatcgaacaagcgaagtcagaaggcgcaacgttggcttacgct
ggcgaatctgcaggactggtatttgcgccgcacgttttcactgaggtgacatccgatatg
gagctggcctacgaagaaattttcgggcctattgcaggaataatgcgcgcgagggatgcc
gatcacgcattagaactggctaacgctactcgttttggactttccgctgcggtcttctca
ggtgacattgaccgcggcgtccatttcgcgaggcaaatccattctggcatggcccatgtg
aacgacatgcctgtggcagatgcccctaacgtcccatttggtggggaaaagaactcaggc
ctcggaagattcaatggcgactgggcaatcgatgagttcaccaccactcaatgggtgtct
gtccagcggaaaccacgccattaccccttctga

DBGET integrated database retrieval system