Photobacterium atrarenae: NNL38_01845 Help Entry NNL38_01845       CDS       T10583                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism pate  Photobacterium atrarenae Brite KEGG Orthology (KO) [BR:pate00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pate03400]     NNL38_01845 (mutT) Enzymes [BR:pate01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      NNL38_01845 (mutT) DNA repair and recombination proteins [BR:pate03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     NNL38_01845 (mutT)  Prokaryotic type     NNL38_01845 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like Motif Other DBs NCBI-ProteinID:  UTV28088 Position 1:371728..372126 Genome browser AA seq 132 aa AA seqDB search MDKKQVWISAGIILNTAQDQVFITRRPAKVHKGGFWEFAGGKVEQGETAEQAVIRELDEE VGIRATELEHFMALEHDYPEKALKFDFFLVKAFEGEAFGKEGQPGEWVELQRLRDYAFPE ANDAVLNKLLAM NT seq 399 nt NT seq  +upstreamnt  +downstreamnt ttggataagaagcaagtttggatctcagccgggatcatactgaacacagcacaggatcag gtttttatcacccgtcgtccggcgaaagtgcacaaagggggattctgggagtttgccggc ggcaaggttgagcaaggcgaaactgccgagcaagcggtgatccgtgagctggatgaggaa gtcgggattcgggcgacagagctggaacattttatggcgctggaacatgattatccggaa aaagcgctgaagtttgactttttcctggtcaaagcgtttgaaggcgaggcgtttggcaaa gaagggcaaccgggggagtgggttgagctgcagcgcttgcgtgattacgcgtttccggaa gccaacgacgccgtgctgaacaagctgctggcgatgtag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (3) Pfam (3) All databases (4) Download RDF

DBGET integrated database retrieval system