KEGG   Pseudomonas brassicacearum DF41: CD58_16125
Entry
CD58_16125        CDS       T03174                                 

Name
(GenBank) thioester reductase
  KO
K16126  L-threonine---[L-threonyl-carrier protein] ligase [EC:6.2.1.70]
Organism
pbc  Pseudomonas brassicacearum DF41
Pathway
pbc01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:pbc00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    CD58_16125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pbc01008]
    CD58_16125
Enzymes [BR:pbc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.70  L-threonine---[L-threonyl-carrier protein] ligase
     CD58_16125
Polyketide biosynthesis proteins [BR:pbc01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Syringomycin synthetase
    CD58_16125
SSDB
Motif
Pfam: AMP-binding AMP-binding_C PP-binding
Other DBs
NCBI-ProteinID: AHL34335
UniProt: W8QDL2
Position
3656978..3658825
AA seq 615 aa
MPIKNTGGSVKPAPAPLTPGVLLHEIFTARAREFPERTAVSDATRSLSYAQLDATSSQLA
ARLRQEGVKDGMLVGMCLPRGVDLVISLLGILKAGGAYVPVDPQYPGKRVEHIVRDSGLS
LMIGELADLPQSASVRVLSLVELLAGPALEPLPDNDRRNPDEAVAYVIYTSGSTGEPKGV
LVAHGNVSRLLESTQRSFAFTEHDVWSMFHSIGFDFSVWEIWGALAHGAHVAVVPYAVSR
SPGDTHRWLADQGVTVLSQTPSAFRGLDDADRSAHAPLALRYVVFGGEALPATVLRPWVA
RHGDQKPALVNMYGITEATVHTTFKRVLGQDLESTAMVSIGAPLDGWRLHLLDADQQPVP
QGNVGELYIEGAGVALGYLNRPALSAERFVQLPGTSSRAYRTGDLVVLGDDGEYRYAGRC
DEQLKVRGFRIEPGEVEACLQTSPAVAAAHVVGHDYGDGDWRLVSYVVPTRGVEAWSEQT
RGEVAALVAANLPDYMRPSAYIALAELPVTAHGKIDKNRLPSPDSVPSTVQHLREAGLTE
QEQFVLKVWSDDIGLKNIGVNDDFFDFGGTSLALIRSLSTLKAHYRINLDPGALADGATA
KVLADCIQRSLVQAQ
NT seq 1848 nt   +upstreamnt  +downstreamnt
atgccgattaagaacactggcggatcggtcaaacccgcgccagcccccctcacgcctggc
gtattgctgcatgaaatattcaccgcccgggcacgtgaattccccgagcgaaccgcggtg
tccgacgccacgcgctcgttgagctatgcgcaactcgatgccacttcgtcacagctggcg
gccagactgcgccaggaaggcgtcaaggacggcatgctggtggggatgtgcctgccacgc
ggcgtcgacctggtcatcagcctgctgggcatcctcaaggcgggcggcgcgtacgtcccg
gtcgacccgcagtaccctggcaaacgtgtcgaacatatcgtgcgcgacagcggcctgagc
ctgatgatcggggaactcgccgacctgccgcagagcgcctccgtgcgtgtcttgtccctg
gtcgagctgctggccggcccggcattggaacccctccccgacaacgaccgccgcaatccc
gacgaggccgtggcgtatgtcatctacacctccggctccaccggtgaacccaagggtgtg
ctggtggcccacggcaacgtcagccgtttgctggaaagcacccagcgctcgttcgccttc
accgagcacgacgtctggtcgatgttccactccatcggtttcgatttttcggtctgggaa
atctggggcgccctcgcccacggtgcccacgtggccgtggtgccttacgcggtctcgcgc
tcgccaggcgacacgcatagatggctggctgaccagggcgtgaccgtcctgagccagacg
ccttcggctttccgtggcctcgatgacgccgaccgttctgcccatgcaccgctggcgctg
cgctatgtggtgttcggcggcgaggcgctgccagccaccgtgctgcgtccgtgggtcgcg
cgacatggcgatcagaagcctgcattggtcaacatgtacggcatcaccgaagccaccgtc
cacaccactttcaaacgtgtactcggccaggacctggaaagcaccgccatggtgtccatc
ggcgcaccactggatggctggcgtctgcacctgctcgatgccgatcagcaaccggtgccc
caaggcaacgtcggggagctgtacatcgaaggcgccggtgtagcgctgggctacctgaat
cgtccagccctgagcgccgagcgcttcgtccagctgccgggcacctcaagccgtgcctat
cgcaccggcgacctggtggtcttgggggatgacggcgagtaccgctacgccggtcgttgc
gatgaacaattgaaggtccgcggtttccggatcgagccaggagaagtcgaggcgtgcctg
cagaccagcccggcggtcgccgcggcccatgtcgtcggtcacgattacggcgatggcgac
tggcgcctggtcagctatgtagtaccgacccggggcgtggaagcctggagcgaacagacc
cgcggcgaagttgccgcgttggtggcggctaatctgccggattacatgcgtccttcggcc
tacattgcgctggcagaattgccggtcacagcccacggcaagatcgacaagaaccgcctg
ccttcgcctgactcggtcccttcgaccgtacagcacctgcgcgaagcgggcctcaccgag
caagagcagttcgtgctcaaagtatggtcggacgatatcggcctgaagaacatcggcgtg
aacgatgacttcttcgatttcggcggtacctccctggccctgatccgctcgttgagtacc
ctcaaggcccattaccggatcaacctggaccctggcgcactggcagacggcgcgaccgcc
aaagtgttggccgactgcatccagcgttcccttgtccaagcccaatga

DBGET integrated database retrieval system