KEGG   Parolsenella catena: Pcatena_10380
Entry
Pcatena_10380     CDS       T05797                                 

Gene name
fabG_2
Definition
(GenBank) 3-oxoacyl-ACP reductase
  KO
K23231  7beta-hydroxysteroid dehydrogenase (NADP+) [EC:1.1.1.201]
Organism
pcat  Parolsenella catena
Pathway
pcat00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:pcat00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    Pcatena_10380 (fabG_2)
Enzymes [BR:pcat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.201  7beta-hydroxysteroid dehydrogenase (NADP+)
     Pcatena_10380 (fabG_2)
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Lact_bio_phlase DUF2652
Other DBs
NCBI-ProteinID: BBH50451
UniProt: A0A3G9JY78
Position
complement(1148103..1148906)
AA seq 267 aa
MTNLREKYGEWGVVLGATEGVGEAFCKKLAEGGMNLVMVGRREELLKEKGEKFHEEYGVD
YKVVRADLSCPDEACEAVFSATEGLDMGFMSYVACLHHFGKFQHTSLEDHEKMVNVNVIS
FLRMFHHFMTIFAEQDRGAVINVSSMTGISSSPWNAEYGAGKAYILKLTEAVACECEKTG
VDVEVCTLGTTLTPTAIKNFPKGPVGEKVVKLALTPDEVADEAFEKLGKEFSIITGERNK
KSVHDWKANHTEDEYIRYMGSFYADQD
NT seq 804 nt   +upstreamnt  +downstreamnt
atgacgaatctgcgcgagaagtacggcgagtggggcgttgtcctcggagccaccgagggc
gtgggcgaggccttctgcaagaagctcgccgagggcggcatgaacctcgtgatggtgggc
cgccgcgaggagcttctcaaggagaagggcgagaagttccacgaggagtacggcgtggac
tacaaggtcgtccgtgcggacctgtcctgccccgacgaggcctgcgaggcggtcttctcg
gccactgagggccttgacatgggcttcatgagctacgtcgcctgcctgcaccactttggc
aagttccagcacacctcgctcgaggaccacgagaagatggtgaacgtcaacgtcatcagc
ttcctgcgcatgttccaccacttcatgacgatctttgccgagcaggaccgcggcgcggtc
atcaacgtctcgtccatgacgggcatctcgagctccccgtggaacgccgagtacggcgcc
ggcaaggcctacatcctcaagctcaccgaggccgtggcctgcgagtgcgagaagacgggc
gtcgacgtcgaggtctgcacgctgggcaccacgctcacgcccacggccatcaagaacttc
ccgaagggcccggtgggcgagaaggtcgtcaagctcgcgctcacgcccgacgaggtggcc
gacgaggcgttcgagaagctcgggaaggagttctccatcatcaccggcgagcgcaacaag
aagagcgtccacgactggaaggccaaccacaccgaggacgagtacatccgctacatgggc
tcgttctacgccgaccaggactag

DBGET integrated database retrieval system