KEGG   Paenibacillus cellulosilyticus: HUB94_07900
Entry
HUB94_07900       CDS       T07813                                 
Name
(GenBank) alpha/beta-type small acid-soluble spore protein
  KO
K06420  small acid-soluble spore protein C (minor alpha/beta-type SASP)
Organism
pcel  Paenibacillus cellulosilyticus
Brite
KEGG Orthology (KO) [BR:pcel00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99978 Cell growth
    HUB94_07900
SSDB
Motif
Pfam: SASP
Other DBs
NCBI-ProteinID: QKS44344
Position
1228296..1228517
AA seq 73 aa
MASQSRSSNQLVVPQASQALEQLKMEAAQSLGVQIPADGYYGNVSTRDAGSLGGYITKKL
VQIAEQQLSGQYR
NT seq 222 nt   +upstreamnt  +downstreamnt
atggcaagccaatcccgcagcagcaatcaactggtggtaccacaagcaagccaagctctg
gaacaattgaaaatggaggctgcgcagtctctcggcgtgcaaatccctgccgatggctac
tacggcaacgtctccactcgcgacgcaggttcgcttggcggttatatcacgaagaagctg
gtgcaaatcgccgaacaacaattgtccggccaatatcgttaa

DBGET integrated database retrieval system