KEGG   Pseudomonas corrugata: AXG94_03680
Entry
AXG94_03680       CDS       T04842                                 

Name
(GenBank) thioester reductase
  KO
K16126  L-threonine---[L-threonyl-carrier protein] ligase [EC:6.2.1.70]
Organism
pcg  Pseudomonas corrugata
Brite
KEGG Orthology (KO) [BR:pcg00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    AXG94_03680
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pcg01008]
    AXG94_03680
Enzymes [BR:pcg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.70  L-threonine---[L-threonyl-carrier protein] ligase
     AXG94_03680
Polyketide biosynthesis proteins [BR:pcg01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Syringomycin synthetase
    AXG94_03680
SSDB
Motif
Pfam: AMP-binding AMP-binding_C PP-binding
Other DBs
NCBI-ProteinID: AOE60911
Position
980282..982126
AA seq 614 aa
MPIKNTGGSVNPAPAPLTPGAFLHEIFTARAREFPERTAVSDATRALSYAQLDAASSQLA
ARLRQEGVKDGMLVGMCLTRSVDLVISLLGILKAGGAYVPVDPQYPGKRVEHIVRDSGLN
LMIGEPANLAQSPSVRVLPLADLLAGPALEPIGDVDRRAPDQAPAYVIYTSGSTGEPKGV
LVAHANVSRLLDSTQREYAFNEHDVWSMFHSIGFDFSVWEIWGALAHGGHVAVVPYDVSR
SPTATRQWLLDQGVTVLSQTPSAFRGLDEADRQAKTPLALRYVVFGGEALPATVLRPWVE
RHGDQKPALINMYGITEATVHTTFKRVLGQDLESAAMVSIGAPLDGWRLNLLDADQQPVP
QGTAGELYIEGAGVALGYLNRPALNSERFVQLPGTSTRAYRTGDLVVLGDDGEYRYAGRC
DEQLKIRGFRIEPGEVEACLQSSPAVAAAHVTGHDYGDGDWRLLTYVVPAQGVNAWTEQV
RSEVAALVAANLPDYMRPSAYIALAQLPVTDHGKIDKKRLPSPDSIEATVHHTADNLTEQ
EQFVLKVWSQDIGLKNIGLNDDFFDFGGTSLALIRSLSTFKAHYQVNLDPGVLANGATAK
VLADCIQRSLVQAH
NT seq 1845 nt   +upstreamnt  +downstreamnt
atgccgattaagaacactggcggatcggtcaaccccgcgccagcccctctcacgcccggt
gcattcctgcatgaaatcttcactgcccgggcccgtgaatttcccgagcgaacggccgtc
tccgacgccactcgcgcgttgagttacgcgcaactcgatgcggcctcttcgcaactggca
gcccgtcttcgccaggaaggcgtcaaggacggcatgctggtcgggatgtgcctgacgcgc
agcgtcgacctggtcatcagcctgctgggcatcctcaaggccggcggcgcctacgtcccg
gtcgacccgcagtaccccggcaagcgcgtggaacacatcgtgcgcgacagcggcctgaac
ctgatgatcggcgagcccgccaatctggcgcagagcccgtccgtgcgcgtcctgcccctg
gccgatctgctggccggcccggcactggagccgattggcgatgtcgaccgccgcgccccc
gaccaggcaccggcctacgtcatctacacctccggctccaccggcgaacccaagggtgtg
ctggtggcccacgccaacgtcagtcgcctgttggacagcacccagcgcgagtacgctttc
aacgaacatgacgtctggtcgatgttccactccatcggcttcgacttttcggtctgggag
atctggggcgcactggcccatggcggccacgtcgccgtggtgccttacgatgtgtcacgc
tcaccaaccgcaacccgtcaatggctgctcgaccagggcgtgaccgtcctcagccagacc
ccgtcggccttccgcggcctcgacgaggcagaccgccaggccaagacgccgctggcgctg
cgctacgtggtattcggcggcgaggctctgccagccacggtgctgcgcccctgggtcgaa
cgccatggtgaccagaagcctgcgctgatcaacatgtacggcatcaccgaagccacagtg
cacaccaccttcaagcgcgtgctgggccaggacctggaaagcgccgccatggtatcgatt
ggtgccccgctggatggctggcgcctgaatctgctcgatgccgatcaacaacccgtgccc
cagggcaccgccggtgagctgtacatcgaaggcgccggcgtagcgctgggttacctgaac
cgcccggcgctgaacagcgagcgcttcgtgcaactgccaggaacttcaactcgcgcctat
cgcactggcgatctggtggtgctgggcgatgacggcgagtaccgctacgccggtcgttgc
gacgagcaactgaaaatccgcggtttccgcatcgagcccggcgaagtcgaagcctgcctg
cagagcagtcccgccgtggccgcggcccatgtgaccggtcacgattacggcgacggcgac
tggcgactgctcacctacgtggtaccggcccagggcgtgaatgcctggaccgaacaggtc
cgcagcgaagtcgccgcgctggtggccgccaacctgccggactacatgcgcccttcagcc
tacatcgccctggcacaactgccggttaccgaccacggcaagatcgacaagaagcgcctg
ccctcgcccgactccatcgaagccaccgtccaccacacggccgacaacctcaccgagcaa
gagcagttcgtgctcaaggtctggtcccaggacatcggcctgaagaacatcggtctgaac
gatgacttcttcgactttggcggcacctccctggcactgatccgctccctgagcactttc
aaggcccattaccaggtcaacctggaccccggcgtactggccaacggtgcaaccgccaag
gtattggccgactgcatccagcgctcccttgtccaagcccattga

DBGET integrated database retrieval system