KEGG   Paenibacillus chitinolyticus: PC41400_18575
Entry
PC41400_18575     CDS       T06610                                 

Definition
(GenBank) Neamine phosphoribosyltransferase
  KO
K13554  neamine phosphoribosyltransferase [EC:2.4.2.49]
Organism
pchi  Paenibacillus chitinolyticus
Pathway
pchi00524  Neomycin, kanamycin and gentamicin biosynthesis
pchi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pchi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    PC41400_18575
Enzymes [BR:pchi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.49  neamine phosphoribosyltransferase
     PC41400_18575
Motif
Pfam: Pribosyltran
Other DBs
NCBI-ProteinID: QAV19558
UniProt: A0A410WYQ2
Position
complement(4079217..4081031)
AA seq 604 aa
MKDNPISLFHELESYVRGSKDRLHHYMYACILEQRLADLLLLSRCGVHPEDSDRLAVRLA
SQRSLCVQAASDIAEGTQEAWGSTPAWPDYKVAKSSVTQKRPELFSLIRVMQELRTPECS
GYDLCDLEVCREDALHWLRDHADPSSPPVLIGVRTGGAFYAPLWASALRQRWGSDAHYHT
VRALRKPSDPGASLYLPEELSMLPDAIDPDTDIVILEDQPHTGGTVLELAGRLSVKYRLN
KSVWVSSPGRLFKIENGRLVKRSDRIPLNAAKKKRIWQMLGSSEEVVEFLLPKLGISDAR
PADLETVPSKSVPHWNDPMYRHDAPFRINPKKTPFFIRQKSTNEPVAFAKFIGKDLFGDF
QFHQLKKFEQYLPDVLAYEDGYVVTKYEPELREMRDLFVNMPSAVTNEICQNMSGYWKTL
LASCQVSGGHPVHPLADHWQAYLGEMEDFIGRKLPSDPDWFEQSLHTEWTSSAHVYTSLP
YANQYGHWRARLSAGQRLKTYRFHVDSTWGGTSSIEVELASFLLENRVRPDDFRLLVNQV
QKEAESLTVEAVADALPIACILQVANLLKQAKGESRLSKELILSETMQSFEYLQAMKPKL
SDVR
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaaggataatccgatctctttgtttcacgaattggagagctacgtgagaggaagcaag
gaccgccttcaccattacatgtacgcctgtatcctggagcagcggttagcggatttgctc
ttgctgagccggtgcggcgtgcatcctgaggacagtgatcgtctggctgtccggctggcc
tctcaacgcagcctatgcgtgcaggctgcttccgacattgcggaaggtacgcaggaggcg
tgggggagtacaccggcatggccggactacaaggttgcaaaatcatccgttacgcagaaa
agaccggagctgttctctttaatcagagtgatgcaggagcttcgtaccccggaatgctcc
gggtatgatttgtgcgacctggaggtttgccgggaggatgctctgcactggctgagagac
catgccgatccgtcttcaccgccagttctcatcggcgttcgaaccggaggtgctttctac
gccccgttatgggcatcggcattgcggcagaggtggggcagtgatgcccactatcacaca
gtccgagccctgcggaagccttcggacccgggcgcgtccttgtatttgcccgaggaactc
tcgatgctgccggacgcaatagatccggatacggatatcgtgattctggaagatcagccg
catacgggcgggactgttctggaactggccggaagacttagcgtgaagtatcggctgaac
aagtcggtctgggtttcttctccgggccggttgttcaaaatcgagaacggccggcttgtg
aagcggagcgatcgtatccctctgaatgcggcgaaaaaaaagcgcatatggcagatgctc
ggcagctcggaagaagtggtggagtttcttctgccgaagctcgggatatctgacgcacgt
ccggcggatttggaaacggtcccttcaaaatccgtgcctcattggaatgatccgatgtat
cgccatgacgctcccttccggattaacccgaagaaaacaccgttttttatccggcaaaaa
agcacgaatgagccggtcgcattcgcaaaatttatcgggaaagatcttttcggcgacttt
caatttcatcagctgaaaaagtttgaacagtatttacctgatgttttagcgtatgaggac
ggttatgtggtgaccaaatatgaaccggaattacgggaaatgagagacctgttcgtcaac
atgccttcagccgtgacaaacgagatttgccaaaacatgtccggttactggaaaacgctg
cttgcttcgtgccaagtaagcggaggtcatcccgttcatcctttagccgatcattggcaa
gcctatctgggagagatggaggacttcatcgggagaaagctgccctctgatccggattgg
ttcgaacaaagtttgcataccgaatggacttcgtccgcccatgtttacacgtccttgcct
tacgcgaaccagtatgggcactggagagcgaggctttcagccgggcagcgcctgaaaacg
taccgttttcacgtcgattccacctggggcggcacttccagtatcgaggtggagctggct
tcgtttcttttggaaaacagggtgaggcccgatgacttccgtctgctggtaaatcaggtg
caaaaagaagccgaatccttaaccgttgaagcagtcgccgatgccctgccgatcgcttgc
atcctgcaagtcgcgaaccttttaaaacaggcgaaaggtgaaagccgtttgtcgaaagag
ctgattttatcggaaacgatgcaatcattcgagtatcttcaggccatgaagccgaagctt
tcggatgtaagataa

DBGET integrated database retrieval system