KEGG   Pseudomonas cichorii: PCH70_26390
Entry
PCH70_26390       CDS       T03002                                 

Name
(GenBank) amino acid adenylation
  KO
K16126  L-threonine---[L-threonyl-carrier protein] ligase [EC:6.2.1.70]
Organism
pci  Pseudomonas cichorii
Pathway
pci01054  Nonribosomal peptide structures
Brite
KEGG Orthology (KO) [BR:pci00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01054 Nonribosomal peptide structures
    PCH70_26390
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:pci01008]
    PCH70_26390
Enzymes [BR:pci01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.70  L-threonine---[L-threonyl-carrier protein] ligase
     PCH70_26390
Polyketide biosynthesis proteins [BR:pci01008]
 Nonribosomal peptide synthetase (NRPS)
  Nonlinear NRPS
   Syringomycin synthetase
    PCH70_26390
SSDB
Motif
Pfam: AMP-binding PP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: AHF67792
Position
3133049..3135136
AA seq 695 aa
MPINPTGERADKLSAPLRPGALLHELFSARAREFPERTALSDETRAVSYAELDAASSALA
ASLRKRGVKDGSLVGLCLERNVDLVITLLAILKAGGAYVPVDPAYPAKRIEHIVQDSGLQ
LIVSTSNLCSIPKTPSLQVLLLNELLAEKSPGEFKASSADASQAPAYVIYTSGSTGEPKG
VLVTHANVSSLLESTQRIYHFTHNDIWSMFHSIGFDFSVWEIWGALAHGGQVAVVPYEIS
RSPETFRQWLISNQVTVLSQTPSAFRGLDEADSQASKRLSLRYVVFGGEALPATVLRPWV
ERHGDALPALINMYGITEATVHTTHKRVRAQDLETSATVSVGKPLDGWTLHLLDEKQQAV
NTGEIGELYIEGAGLTLGYLNRPGLTAERFVTLPGSGIRAYRTGDLLKLDEHGEYLYAGR
SDQQLKVRGFRIEAGEVEAALQSSKSISASHVTAYDYGQGDLRLVAYVVPSDGSQTVTQE
LRSELAALAAQQLPDYMRPSAYIGLATLPVTAHGKIDKQQLPSPLEHTSTTTDQGNLSEQ
ELYVLKAWSDDIGLKGIGLNDDFFDHGGTSLALIRSLSLLKAHYKVDLNPGVLADGATAK
VLAASIRNSLAKTEQGNLSEQELHVLKVWSDDIGLKGIGLNDDFFDHGGTSLALIRSLSL
LKAHYKVDLNPGALANGATAKVLADSIRTSLANAH
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgccgatcaacccgacaggcgaaagggcagacaagctgtcagccccactgcgacccggc
gccttgctgcacgaattgttcagtgccagggccagagaatttcccgaaagaacagcgtta
tccgatgaaacccgagccgtcagttacgcagagctcgacgcagcatcttcggcgctggca
gccagcctgcgcaaacgcggcgtcaaggacggcagtctagtcggcctgtgcctggagcgt
aatgtcgatctggtcattaccctgctcgccattctcaaggccggcggtgcctatgtcccg
gtcgatccggcctaccctgcaaaacgcatcgagcacatcgttcaggacagcggtctgcaa
ctgatcgtcagcaccagtaatctgtgcagcattcccaagacgccttcactgcaagtgctg
ctcctgaacgagctgcttgcagaaaagagccctggcgagttcaaggccagcagcgccgat
gcgtctcaggctccggcctatgtgatctacacctcgggctccacgggcgaacccaaaggt
gtgctggtaacccatgccaacgtgagcagcctgctggaaagcacccaacgcatttaccat
ttcactcacaacgatatctggtcgatgttccactccatcggcttcgatttctcggtctgg
gaaatctggggcgctctcgcccacggtggccaggttgccgtcgtgccttacgaaatctcc
cgctcacctgaaaccttcaggcagtggctgatcagcaatcaggtcaccgtcctgagccag
acgccgtcggccttccgcggtcttgacgaagcagacagtcaggccagcaaacgtctgtcg
ctccgctacgtggtattcggtggcgaagcattgccggcgaccgtactgcgtccgtgggtc
gaacgtcatggtgacgcgctgccagccctgatcaacatgtatggcatcaccgaagccacc
gtgcatacgacccacaaacgggtacgcgctcaggaccttgaaacatcggccaccgtgtct
gtaggcaaaccgctggatggctggaccctgcacctgctggatgaaaaacagcaagcggtg
aacacaggcgaaatcggcgagctgtatatcgaaggcgccgggctgaccctgggctatctg
aatcgcccgggcctgacggccgagcgctttgtaaccctgccaggcagcggcatccgtgcc
tatcgcaccggcgacctgctcaagctcgacgagcatggcgaatacctctacgccggacgt
agcgaccagcaactcaaggttcgcggcttccgtatcgaggctggcgaagtcgaagccgcc
ctgcagtcgagcaagagcatttccgccagtcacgttaccgcctatgactacggtcagggc
gatctgcgactggtggcctacgtcgttccttccgatggttcacagacggtgactcaggaa
ctgcgcagcgagctggcggcactggccgcacaacagttgccggactacatgcgtccttcg
gcttacattggtctggcgacactgccagtcaccgcccacggcaagatcgacaaacagcaa
ctgccttcgccgcttgagcacaccagcaccacaaccgatcagggcaacctgtcggaacag
gagctgtatgtactcaaggcctggtccgatgatatcggcctcaagggcataggcctgaac
gacgatttcttcgatcacggcggtacctcgctggccctgatccgctccctcagcctgctc
aaggctcactacaaggtcgacctcaaccccggcgttcttgcggacggagccactgccaag
gttcttgccgccagcattcgcaactcccttgccaaaaccgagcagggcaacctgtcggaa
caggagctgcatgtactcaaggtctggtccgatgacatcggcctcaagggtattggcctg
aacgacgatttcttcgatcacggcggtacctcgctggccctgatccgctccctcagcctg
ctcaaggctcactacaaggtcgacctcaaccctggcgctctcgcgaacggagccactgcc
aaggttcttgccgacagcattcgcacctcccttgccaacgctcattga

DBGET integrated database retrieval system