KEGG   Candidatus Protochlamydia amoebophila: PC_RS00900
Entry
PC_RS00900        CDS       T00172                                 
Name
(GenBank) unnamed protein product
Organism
pcu  Candidatus Protochlamydia amoebophila
SSDB
Motif
Pfam: UPF0242 PAS_12 MAP65_ASE1 DUF4407 RseC_MucC PAS_8 SSXT
Other DBs
NCBI-ProteinID: CAF22908
UniProt: Q6MEU1
Position
274184..275491
AA seq 435 aa
MNQEIVFFSMKFKTTNRQFFSAAVIFFYLLPLLFFVTYSIGLMPHQKSWSILTLGLLLVA
IGSICLILLAYYWEIGLKTKWQGESAILSSQSSFTSEKENKVTALDPAFTLVPLEEAPSF
TTKEEVTLLNSLENLNDEQRKREEELALKQSEIQKLVEENQSLISQTQQTQQDFADYKLF
SEEQLKQKQLQINFLQQTIEDQRSEMEKRQDQIFHLDTKVHDLSYEIKTLLYLHETESNT
SKKEELFKNNSNGPFIEDFDDFPTHTSIIPSLDLKNGYWVKTTIEASALLKKCINMAQKM
TGANYYNNETTRYREFSTSNYAIDQRRLFDNLKNEEGGLIVVFSQKDQKLLFANQQSKAL
LGWSADKLISDFAQIIQEGLNEWRRGLAALTTAAESQIRLLAKNKNGQEVLLSCQLGIIP
SGLFRSYVIAIFYPT
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgaatcaggaaatcgtattttttagtatgaaatttaaaacaacaaatcgacagtttttt
tctgcagccgttatttttttctatcttctccctttattattttttgttacctatagcata
gggttaatgccccatcagaaaagttggtctatccttactttaggacttcttctagttgcc
attggatctatttgtctaattttgcttgcttattactgggaaataggcttaaaaacgaag
tggcagggagagtcagcgatcctttcttctcaaagcagttttacttctgaaaaagagaat
aaagtgacggcattggatcccgcatttacattagtgcctttggaagaagctccttctttt
acaactaaagaagaggtgactttattaaattcgctggaaaacctcaacgatgaacaaaga
aaaagggaagaagaattagctcttaagcaatctgaaattcaaaaattagttgaagaaaat
caatcccttatatcgcaaactcagcaaactcaacaagattttgcagactataaacttttt
tctgaagaacaattaaagcaaaaacaattacaaattaactttttacagcagacaatagaa
gatcagcgtagcgaaatggaaaaaagacaagatcaaatttttcatcttgatacaaaggtg
catgatttgagttatgaaattaaaactctattatatttgcatgaaacagaatcaaatact
tctaaaaaagaagaattgtttaaaaataactccaatggaccatttattgaagacttcgat
gattttcccactcatacttctatcattccttcgttagatcttaaaaacggttattgggtc
aaaacgacaattgaggctagtgcattattgaaaaaatgtataaatatggctcaaaaaatg
actggggctaattattacaataatgaaactactcgttatagagaattttcaacttctaac
tatgctattgatcagcggcgtctttttgacaatttaaaaaatgaagaaggtgggttgatt
gttgtattttctcagaaagatcaaaaattattatttgccaatcaacagtccaaagccttg
cttggatggagtgcagataagctcatttcagattttgctcaaattattcaagaaggattg
aacgaatggagaagaggattagctgctcttacaacggcagccgagtcgcaaattcgattg
cttgctaaaaataaaaatgggcaagaagttctattgagttgccaacttggcattattcct
tcaggtttgtttagaagttatgtgattgctatcttttacccaacataa

DBGET integrated database retrieval system