Pasteurella dagmatis: 4362423_02089 Help Entry 4362423_02089     CDS       T05467                                  Symbol mutT Name (GenBank) mutator mutT protein   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism pdag  Pasteurella dagmatis Brite KEGG Orthology (KO) [BR:pdag00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:pdag03400]     4362423_02089 (mutT) Enzymes [BR:pdag01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      4362423_02089 (mutT) DNA repair and recombination proteins [BR:pdag03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     4362423_02089 (mutT)  Prokaryotic type     4362423_02089 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX NUDIX_4 Nudt16-like NUDIX_2 DUF4160 DUF6480 Motif Other DBs NCBI-ProteinID:  SNV84679 Position 1:2236426..2236830 Genome browser AA seq 134 aa AA seqDB search MKKPVVQVAAGIIRNEFGQIYLTQRLEGQDFAQSLEFPGGKVDKGETPEQALKRELEEEI GIHILHAELYERFQFEYPTKLISFYFYLVDEWFGEPFGREGQEGFWIAQNELDAGQFPPA NAKLIQRLLAEENH NT seq 405 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaacctgtagttcaagtggccgctggcattattcgcaatgagtttgggcaaatc tatttaactcagcgtttagaagggcaagacttcgcacagtctttggaatttcctggtgga aaagttgataaaggtgaaacgcctgaacaggcattaaaacgtgagttagaagaagagatt ggtatccatattttacacgctgagctttatgaacgttttcaatttgaatatccaactaag ttgatttctttctatttttatttagttgatgaatggtttggtgagccttttggacgagaa gggcaggaaggtttttggattgctcaaaatgaattagatgcgggacagtttcctcctgct aatgcaaaacttattcagcgcttattagctgaagaaaatcactaa

All links   Gene (2) NCBI-PROTEINID (1) OC (1) Protein domain (6) Pfam (6) All databases (8) Download RDF

DBGET integrated database retrieval system