KEGG   Pseudomonas sp. ATCC 13867: H681_14070
Entry
H681_14070        CDS       T02524                                 
Name
(GenBank) P-hydroxybenzaldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
pdr  Pseudomonas sp. ATCC 13867
Pathway
pdr00623  Toluene degradation
pdr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pdr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    H681_14070
Enzymes [BR:pdr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     H681_14070
SSDB
Motif
Pfam: Aldedh DUF1487
Other DBs
NCBI-ProteinID: AGI24684
UniProt: M4WXZ4
Position
3175250..3176725
AA seq 491 aa
MSFPLPPYADLDLQPLAGHWRHGASPRQLEVRDPYTDQCLLSLPLATRADLDQACQAARA
AQVEWAAQAPSARAAVLLRAVELFDRRREEIIGWIIRESGSTRIKAEIEWGAARAITLEA
ASFPSRVHGRILESDIPGKESRVYRRPLGVVGIISPWNFPLHLTQRSLAPALALGNAAVV
KPASDTPVSGGLLLARLFEEAGLPAGVLSVVVGAGSEIGDAFVEHPVPALISFTGSTPVG
RSIGRLASGGAHLKHVALELGGNSPFVVLADADLERAVHAAVVGKFLHQGQICMAINRII
VEQPLYEAFCERYAERVQALRCGDPSDPATVIGPVINQRQLDGLLGKIDTARAEGARVLV
EGAVAGRVLPPHVFADVRPDMEIAREEIFGPLVGIQPARDAEHALELANASEFGLSSAVF
GGDLERTVRFARRIHAGMTHVNDIPVNDAPNAPFGGEKNSGIGRFNGDWAIDEFTTDHWL
SVQHGPRPYPF
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgagcttccccctgcccccctatgccgatctggacctgcaaccgctggccggccactgg
cgccacggcgcctcgccgcgccagctggaggtacgcgatccctacaccgaccagtgcctg
ctgagcctgccgctggccacccgcgctgacctcgaccaggcctgccaggccgcccgcgcc
gcccaggtcgaatgggccgcacaagccccctcggcgcgtgcggcggtgctgctgcgcgcg
gtcgagctgttcgaccggcgccgcgaggaaatcatcggctggatcatccgcgaatccggt
agcacccggatcaaggccgagatcgaatggggcgccgcccgcgccatcaccctggaagcg
gcgtcgttccccagccgggtccacgggcgcatcctcgaatcggacatccccggcaaggaa
agccgcgtctaccgccgcccgctgggcgtggtggggatcatcagcccgtggaacttcccc
ctgcacctgacccagcgctccctggcgccggccctggcgctgggcaacgcggcggtggtc
aagccggccagcgacaccccggtcagcggcggcctgctgctggcgcgactgttcgaggaa
gccgggttgccggccggcgtgctgagcgtcgtggtcggcgccggtagcgagatcggcgac
gccttcgtcgagcacccggtgccggcgctgatctccttcaccggctcgaccccggtgggc
cgctccatcgggcgcctcgccagcggcggcgcgcacctcaagcacgtggccctggagctg
ggcggcaacagcccgttcgtggtgctggccgacgccgacctggagcgcgcagtgcacgcc
gccgtggtgggcaagttcctccaccaggggcagatctgcatggcgatcaaccgcatcatc
gtcgagcagcccctctacgaagcgttctgcgagcgctatgccgaacgcgtgcaagcgctg
cgctgcggcgacccgagcgacccggccacggtgatcggcccggtgatcaaccaacgtcag
ctcgacggcctgctgggcaagatcgacacggcccgcgccgagggcgcccgggtgctggtg
gagggcgccgtggccggccgcgtgctgccgccccacgtgttcgccgacgtacgcccggac
atggagatcgcccgcgaggaaatcttcggtccgctggtcggcatccagccggcacgtgat
gccgagcacgcgctggagctggccaacgccagcgagttcggcctgtccagcgcggtgttc
ggcggcgacctggaacgcaccgtgcgcttcgcccggcggattcacgccggcatgacccac
gtgaacgacatcccggtgaacgacgcgcccaatgcgcccttcggcggcgagaagaactcc
ggcatcggccgcttcaacggcgactgggcgatcgacgagttcaccaccgaccactggctg
agcgtgcagcacggcccgcgtccctatcccttctga

DBGET integrated database retrieval system