KEGG   Syntrophotalea acetylenivorans: A7E78_00110
Entry
A7E78_00110       CDS       T04594                                 

Name
(GenBank) hypothetical protein
  KO
K20625  acetylene hydratase [EC:4.2.1.112]
Organism
pef  Syntrophotalea acetylenivorans
Pathway
pef00625  Chloroalkane and chloroalkene degradation
pef01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pef00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A7E78_00110
Enzymes [BR:pef01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.112  acetylene hydratase
     A7E78_00110
SSDB
Motif
Pfam: Molybdopterin Molydop_binding MoeA_C
Other DBs
NCBI-ProteinID: APG26405
UniProt: A0A1L3GKJ3
Position
19551..21749
AA seq 732 aa
MASKKHVACQSCDINCVVEAVVKDDGKIQTKSISEPHPTTPPNSICMKSVNADTIRTHKD
RVLYPLKNVGSKRGEQRWERISWDQALDEIAEKLKKIIAKYGPESLGVSQTEINQQSECG
TLRRFMNLLGSPNWTAAMYMCIGNTAGVHRVTHGSYSFASFADSNCLLFIGKNLSNHNWV
SQFNDLKAALKRGCKLIVLDPRRTKVAEMADIWLPLRYGTDAALFLGMINVIINEQLYDK
EFVENWCVGFEELKERVQEYPLDKVAEITGCDAEEIRKAAVMFATEGPASIPWAVSTDMQ
KNSTSAIRAQCILRAITGSLKQGAELLGLPHSEFVSVSQIQMHEALPEEKKKIQLGTERY
PLLTYTGMSAFEEPSARVYGEENRYFHNMAAFMANPTDMFTAMASEKPYPVKAFFTFASN
ALMGFANQENALAGLMNQELVVCYDQFINPTAQLADYILPGDHWLERPVVTPNWEGIPFA
NTSQQVVEPAGEAKDEYYVVRELAIRMGLEEHFPWKDRAELMNYRISPTGKDWEEFQKQF
TYPSNIPDYFAPGGVGVATPSGKVELYSSVLEGLGYDPLPYYKEPEQTPISDPELAKEYP
LTLFAGLREDPGFNSCYMQEGPLRNVEPDPVALLHPKTAQSLGLPSGEWIWVETTHGRLK
LLLKHDGAQPEGTIRIPHGRWCPEQEGGPETGFSGAMLHNDAMVLSDDDWNLDPEQGLPN
LRGGILAKAYKC
NT seq 2199 nt   +upstreamnt  +downstreamnt
atggctagcaagaagcacgttgcctgtcagtcctgcgatattaattgtgttgtagaggct
gtagtgaaggatgacggtaagatccaaacaaagagtatctcagagcctcacccgacaact
ccccccaatagtatttgtatgaagtcggtgaatgcggacacgatcaggactcataaggat
cgtgtgctctatcctctgaaaaacgtgggtagtaagaggggagagcaaaggtgggagcga
atcagttgggaccaggcattggatgaaattgccgaaaagttgaaaaagattatagcgaaa
tacggtccggagtcccttggtgtaagccagactgagattaatcagcaaagcgaatgtgga
acgctccggagattcatgaatctcttgggtagcccgaactggactgccgccatgtatatg
tgtatcgggaatacagccggagttcatagagtaactcatggaagttactcttttgcgagt
tttgccgactctaattgccttttgttcattggtaaaaatctcagtaatcataattgggtc
tcccagttcaatgaccttaaggctgctttaaaaagaggctgcaagcttattgtgcttgat
ccgcgcagaaccaaggtcgcagagatggcggatatttggcttcctcttcgctatgggaca
gatgcagctctatttctcgggatgattaacgttatcatcaatgaacagttgtacgacaaa
gagtttgttgaaaactggtgtgttgggtttgaagagcttaaagaacgggttcaggaatat
cctttagacaaagttgcggaaataaccggatgcgatgccgaagaaatcaggaaagctgct
gttatgttcgcaaccgaggggcctgcatccataccttgggctgtttcaactgacatgcag
aaaaacagtacgtcggcgatccgcgctcaatgcattttaagggcaattactggcagcctt
aagcaaggggcggagttgttggggctcccccattcagagttcgtgtctgtttcccagatt
cagatgcacgaagcactgcctgaagaaaagaaaaagattcagctcggtacagaacggtac
ccgctccttacatacacggggatgagtgcgtttgaagagccgtcagcaagagtctatggg
gaagaaaataggtacttccacaatatggccgcgtttatggccaatccgacggatatgttt
acggctatggcttccgagaaaccgtatcctgtgaaggccttctttacatttgccagcaat
gcgctgatgggctttgcaaatcaggaaaacgcactcgctggtctcatgaatcaggaattg
gttgtttgttacgatcagttcatcaaccctacagcgcagcttgccgattatattctcccc
ggtgatcactggctggagaggcctgttgttacgccgaattgggaaggtattcctttcgcc
aatacttcccagcaagttgtcgaaccggctggcgaagccaaagatgaatattatgtcgtc
agagagctggccatcaggatgggacttgaagagcatttcccgtggaaggaccgggctgaa
ttgatgaactacaggatcagcccgactggtaaggattgggaagagttccagaagcaattc
acctatccgtctaatattcccgattattttgccccgggtggggtaggcgtggcgacccca
tcaggaaaagttgagctgtattcaagtgtgcttgaaggacttgggtatgatccgttgccg
tactacaaggagccggagcagactccaatcagtgacccggaacttgcgaaggaatatccc
ttaaccctttttgctggtctgcgtgaagatccgggctttaactcctgctatatgcaggaa
gggccccttagaaacgtagagcccgatcctgttgccttgcttcatccaaaaactgcgcag
tcccttggacttccctccggcgaatggatctgggttgagacaactcatgggaggttgaag
ttgctcctcaagcatgatggtgcgcagccggaaggtacgataagaataccccatggacgg
tggtgccctgaacaggaaggtggtcctgagactggatttagtggagccatgctgcataat
gatgccatggtattaagtgatgatgactggaatctcgatccggagcagggtttgccaaat
cttagaggcggtattcttgcgaaggcatataaatgctga

DBGET integrated database retrieval system