GenomeNet

Database: Pfam
Entry: ASFV_L11L
LinkDB: ASFV_L11L
Original site: ASFV_L11L 
#=GF ID   ASFV_L11L
#=GF AC   PF05293.14
#=GF DE   African swine fever virus (ASFV) L11L protein
#=GF AU   Moxon SJ;0000-0003-4644-1816
#=GF SE   Pfam-B_7869 (release 7.7)
#=GF GA   25.00 25.00;
#=GF TC   162.30 162.10;
#=GF NC   23.20 20.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9603334
#=GF RT   A conserved African swine fever virus right variable region
#=GF RT   gene, l11L, is non-essential for growth in vitro and virulence
#=GF RT   in domestic swine. 
#=GF RA   Kleiboeker SB, Kutish GF, Neilan JG, Lu Z, Zsak L, Rock DL; 
#=GF RL   J Gen Virol 1998;79:1189-1195.
#=GF DR   INTERPRO; IPR007957;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   L11L is an integral membrane protein of the African swine fever
#=GF CC   virus (ASFV) which is expressed late in the virus replication
#=GF CC   cycle. The protein is thought to be non-essential for growth in
#=GF CC   vitro and for virus virulence in domestic swine [1].
#=GF SQ   1
#=GS A0A0A1DYF3_ASF/1-77  AC A0A0A1DYF3.1
A0A0A1DYF3_ASF/1-77             MLEPILVMAPIPLVLIFLYSYFKIKLHKLITIALFLGCLFFILRDFCFPPMLWTQLHNITSSIN-ILGNNSFQVKCNK
#=GC seq_cons                   MLEPILVMAPIPLVLIFLYSYFKIKLHKLITIALFLGCLFFILRDFCFPPMLWTQLHNITSSIN.ILGNNSFQVKCNK
//
DBGET integrated database retrieval system