GenomeNet

Database: Pfam
Entry: Anti-RecBCD_p2
LinkDB: Anti-RecBCD_p2
Original site: Anti-RecBCD_p2 
#=GF ID   Anti-RecBCD_p2
#=GF AC   PF11043.11
#=GF DE   Bacteriophage P22, anti-RecBCD protein 2
#=GF PI   DUF2856;
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF AU   Finn RD;0000-0001-8626-2148
#=GF SE   PRODOM
#=GF GA   25.00 25.00;
#=GF TC   31.30 144.40;
#=GF NC   23.70 22.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10669596
#=GF RT   Bacteriophage P22 Abc2 protein binds to RecC increases the 5'
#=GF RT   strand nicking activity of RecBCD and together with lambda bet,
#=GF RT   promotes Chi-independent recombination.
#=GF RA   Murphy KC;
#=GF RL   J Mol Biol. 2000;296:385-401.
#=GF DR   INTERPRO; IPR020500;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This phage protein modulates the activity of the host recBCD
#=GF CC   nuclease promoting phage growth and recombination, and protects
#=GF CC   the linear double stranded DNA from exonuclease degradation [1].
#=GF SQ   46
#=GS K7PH21_9CAUD/1-98      AC K7PH21.1
#=GS A0A192Y6Y1_9CAUD/1-97  AC A0A192Y6Y1.1
#=GS A9MNQ2_SALAR/1-97      AC A9MNQ2.1
#=GS A0A1V0E5L7_9CAUD/1-97  AC A0A1V0E5L7.1
#=GS K7PK21_9CAUD/1-98      AC K7PK21.1
#=GS I1TEE6_9CAUD/1-97      AC I1TEE6.1
#=GS A0A5C0CBU5_9CAUD/1-97  AC A0A5C0CBU5.1
#=GS A0A088CQ60_9CAUD/1-98  AC A0A088CQ60.1
#=GS A0A0N6WGF7_BPP22/1-64  AC A0A0N6WGF7.1
#=GS I6R984_9CAUD/1-97      AC I6R984.1
#=GS K7P836_9CAUD/1-97      AC K7P836.1
#=GS A0A5Q2F0N0_9CAUD/1-98  AC A0A5Q2F0N0.1
#=GS B8K1D7_9CAUD/1-97      AC B8K1D7.1
#=GS ABC2_BPP22/1-97        AC P11191.1
#=GS I6R0R5_9CAUD/1-97      AC I6R0R5.1
#=GS A0A220NQV5_9CAUD/1-97  AC A0A220NQV5.1
#=GS K7PGY5_9CAUD/1-98      AC K7PGY5.1
#=GS A0A2H4FNA1_9CAUD/1-97  AC A0A2H4FNA1.1
#=GS K7P845_9CAUD/1-97      AC K7P845.1
#=GS A0A4Z0N8N9_SALET/1-97  AC A0A4Z0N8N9.1
#=GS Q9AZ31_BPHK6/1-98      AC Q9AZ31.1
#=GS Q8HAH7_BPST6/1-97      AC Q8HAH7.1
#=GS K7P6I5_9CAUD/1-98      AC K7P6I5.1
#=GS C6ZR34_9CAUD/1-97      AC C6ZR34.1
#=GS K7P875_9CAUD/1-97      AC K7P875.1
#=GS A0A7D7EXP0_9CAUD/1-97  AC A0A7D7EXP0.1
#=GS Q76H42_9CAUD/1-97      AC Q76H42.1
#=GS A0A6L6IHJ2_9ESCH/1-98  AC A0A6L6IHJ2.1
#=GS A0A1R3Y5T7_9CAUD/1-97  AC A0A1R3Y5T7.1
#=GS B9UDN0_9CAUD/1-97      AC B9UDN0.1
#=GS A5VWB0_9CAUD/1-98      AC A5VWB0.1
#=GS A0A513ZWX8_9CAUD/1-97  AC A0A513ZWX8.1
#=GS A0A2Z5HPW4_9CAUD/1-97  AC A0A2Z5HPW4.1
#=GS A0A0N7CDR4_BPP22/1-97  AC A0A0N7CDR4.1
#=GS A0A2D1GLX2_9CAUD/1-98  AC A0A2D1GLX2.1
#=GS K7PH66_9CAUD/1-97      AC K7PH66.1
#=GS K7P7E6_9CAUD/1-97      AC K7P7E6.1
#=GS A0A5C0CAJ0_9CAUD/1-97  AC A0A5C0CAJ0.1
#=GS Q716F0_BPSFV/1-98      AC Q716F0.1
#=GS G8C7L1_9CAUD/1-97      AC G8C7L1.1
#=GS K7PHQ4_9CAUD/1-97      AC K7PHQ4.1
#=GS A0A3G3M6R6_9CAUD/1-97  AC A0A3G3M6R6.1
#=GS A0A220NRR0_9CAUD/1-98  AC A0A220NRR0.1
#=GS Q9MCR1_BPHK7/1-97      AC Q9MCR1.1
#=GS Q5G8U3_9CAUD/9-105     AC Q5G8U3.1
#=GS Q9MCT7_BPHK0/1-97      AC Q9MCT7.1
K7PH21_9CAUD/1-98                 MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
A0A192Y6Y1_9CAUD/1-97             MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.TDPRLRDYRSRYGAISNN
A9MNQ2_SALAR/1-97                 MPAPLYGADDPRRCSGKSVSEVLDKFRRNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTAIRPFRKATYTKFIE.IDPRLRDYRSRYGAISNN
A0A1V0E5L7_9CAUD/1-97             MPAPMYGANDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTKFIE.IDQRLRDYRSRYGAISNN
K7PK21_9CAUD/1-98                 MPAPLYGADDPLRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYHSRYGAISND
I1TEE6_9CAUD/1-97                 MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.TDPRLRDYRSRYGAISNN
A0A5C0CBU5_9CAUD/1-97             MPAPLYGADDPRRCSGNSVSEVLEKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTKFIE.TDPRLRYYRSRYGAISNN
A0A088CQ60_9CAUD/1-98             MPAPLYGADDTRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
A0A0N6WGF7_BPP22/1-64             ---------------------------------MSLPQETKEEKEFRHCIWLAEKEERERIYQTAIRPFRKATYTKFIE.IDPRLRDYRSRYGAISNN
I6R984_9CAUD/1-97                 MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.IDPRLKNYRSRYGATSNN
K7P836_9CAUD/1-97                 MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKKEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
A0A5Q2F0N0_9CAUD/1-98             MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
B8K1D7_9CAUD/1-97                 MPAPLYGADDPRNCSGSSKSEVLENIKNNLDAFLALPPETKAERKYRRDIQLAEKQEKDRINETAIRPFRKATYTKFIE.IDPRLKNYRSRYGAISNN
ABC2_BPP22/1-97                   MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTAIRPFRKATYTKFIE.IDPRLRDYRSRYGAISNN
I6R0R5_9CAUD/1-97                 MPAPLYGADTPCRCSGNSVSEVLEKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTKFIE.IDPRLKNYRSRYGSISNN
A0A220NQV5_9CAUD/1-97             MPAPLYGADDPRRCSGNSVSEVLEKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.IDPRLKNYRSRYGAISNN
K7PGY5_9CAUD/1-98                 MPAPLYGADDARRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKQERERIYQTSIRPFRKATYTNFPEyIDPRLRNYRSRYGAISND
A0A2H4FNA1_9CAUD/1-97             MPAPVYGANEPRRCSGNSVSEVLEKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.IDPRLKNYRSRYGAISNN
K7P845_9CAUD/1-97                 MPAPLYGADDARRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
A0A4Z0N8N9_SALET/1-97             MPAPLYGADDPRRCSGNSVSEVLDKFRNNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
Q9AZ31_BPHK6/1-98                 MPAPLYGADDPLRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYHSRYGAISND
Q8HAH7_BPST6/1-97                 MPAPLYGADDPRRCSGNSVSEVLEKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.IDPRLKNYRSRYGAISNN
K7P6I5_9CAUD/1-98                 MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
C6ZR34_9CAUD/1-97                 MPAPMYGANDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.IDPRLRDYRSRYGAISNN
K7P875_9CAUD/1-97                 MPAPLYGEDDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
A0A7D7EXP0_9CAUD/1-97             MPAPLYGADDPRNCSGSSKSEVLENIKNNLDAFLALPPETKAERKYRRDIQLAEKQEKDRINETAIRPFRKATYTKFIE.IDPRLKNYRSRYGAISNN
Q76H42_9CAUD/1-97                 MPAPLYGADDPRNCSGSSKSEVLENIKNNLDAFLALPPETKAERKYRRDIQLAEKQEKDRINETAIRPFRKATYTKFIE.IDPRLKNYRSRYGAISNN
A0A6L6IHJ2_9ESCH/1-98             MPAPLYGADNPCRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYINFPEyIDPRLRNYRSRYGAISNN
A0A1R3Y5T7_9CAUD/1-97             MPAPLYGADDPRRCSGNSVSEVLEKFRKNYDLIMSLPQETKEKKKFRHCIWLAEKEERERIYQTSIRPFRKATYTKFIE.IDPRLRDYRSRYGAISNN
B9UDN0_9CAUD/1-97                 MPAPMYGANDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTQFIE.IDPRLRDYRSRYGAISNN
A5VWB0_9CAUD/1-98                 MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
A0A513ZWX8_9CAUD/1-97             MPAPLYGADDPRRCSGNSVSEVLEKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTKFIE.TDPRLRYYRSRYGAISNN
A0A2Z5HPW4_9CAUD/1-97             MPKPLFDCNNPLRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTKFIE.IDPRLKNYRSRYGSISNN
A0A0N7CDR4_BPP22/1-97             MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDLIMSLPQETKEEKEFRHCIWLAEKEERERIYQTAIRPFRKATYTKFIE.IDPRLRDYRSRYGAISNN
A0A2D1GLX2_9CAUD/1-98             MPAPQYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
K7PH66_9CAUD/1-97                 MPAPLYGADDPRRCSGKSVSEVLDKFRKNYDQIMSLPQETKDEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
K7P7E6_9CAUD/1-97                 MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
A0A5C0CAJ0_9CAUD/1-97             MPAPLYGADDPRNCSGSSKSEVLENIKNNLDAFLALPPETKAERKYRRDIQLAEKQEKDRINGTAIRPFRKATYTQFIE.IDPRLKNYRSRYGAISNN
Q716F0_BPSFV/1-98                 MPAPQYGADDPRRCSGNSVSEVLDKFRKNYDRIMSLQQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
G8C7L1_9CAUD/1-97                 MPAPLYGADDARRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERDRIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
K7PHQ4_9CAUD/1-97                 MPAPLYGADDPRRCSGKSVSEVLDKFRKNYDQIMSLPQETKDEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
A0A3G3M6R6_9CAUD/1-97             MPAPLYGADDARRCSGNSVSEVLDKFRKNYNRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
A0A220NRR0_9CAUD/1-98             MPAPLYGADDARRCSGNSVSEVLDKFRKNYDRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPEyIDPRLRNYRSRYGAISND
Q9MCR1_BPHK7/1-97                 MPAPLYGADDPLRCSGNSVSEVLDKFRKKYDLIMSLPQETKEEKEFRHCIWLAEKEEREQIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
Q5G8U3_9CAUD/9-105                MPKPLFDYNNPLRCSGNSVSEVLDKFRKNYDLIMSLPQETKAERDFRNSIWLAERNEKELIRQTSIRPFRKAIYTKFIE.IDPRLRNYRSRYGMISNN
Q9MCT7_BPHK0/1-97                 MPAPLYGADDARRCSGNSVSEVLDKFRKNYNRIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYTHFPE.IDPRLRNYRSRYGAISND
#=GC seq_cons                     MPAPLYGADDPRRCSGNSVSEVLDKFRKNYDhIMSLPQETKEEKEFRHCIWLAEKEERERIYQTSIRPFRKATYT+F.E.IDPRLRNYRSRYGAISNs
//
DBGET integrated database retrieval system