GenomeNet

Database: Pfam
Entry: CBL
LinkDB: CBL
Original site: CBL 
#=GF ID   CBL
#=GF AC   PF18973.2
#=GF DE   Putative Chitin binding like
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   Val
#=GF GA   25.00 25.00;
#=GF TC   28.80 80.90;
#=GF NC   23.70 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   22241993
#=GF RT   The cysteine rich necrotrophic effector SnTox1 produced by
#=GF RT   Stagonospora nodorum triggers susceptibility of wheat lines
#=GF RT   harboring Snn1.
#=GF RA   Liu Z, Zhang Z, Faris JD, Oliver RP, Syme R, McDonald MC,
#=GF RA   McDonald BA, Solomon PS, Lu S, Shelver WL, Xu S, Friesen TL;
#=GF RL   PLoS Pathog. 2012;8:e1002467.
#=GF DR   INTERPRO; IPR044057;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family includes host-selective toxins such as SnTox1 found
#=GF CC   in S. nodorum. SnTox1 is a necrotrophic effector contains 6
#=GF CC   cysteine residues, a common feature for some fungal avirulence
#=GF CC   effectors such as the Avr and ECP effectors from Cladosporium
#=GF CC   fulvum. The high content of cysteine residues and high stability
#=GF CC   suggest that SnTox1 may function in the plant apoplastic space
#=GF CC   which is abundant in plant defense components. Protein sequence
#=GF CC   analysis indicate that SnTox1 contains a C-terminal chitin
#=GF CC   binding (CB) like motif. Three-dimensional (3D) structure-based
#=GF CC   sequence alignment suggested that the putative CB motif in
#=GF CC   SnTox1 was more similar to those of plant-specific ChtBDs than
#=GF CC   to Avr4 proteins, which are related to invertebrate ChtBDs.
#=GF CC   Furthermore, SnTox1 contained all secondary-structure-related
#=GF CC   residues including the strictly conserved b-strand-forming 'CCS'
#=GF CC   motif found only in plant-specific ChtBD1 proteins [1].
#=GF SQ   4
#=GS B2W548_PYRTR/18-65  AC B2W548.1
#=GS Q0UP27_PHANO/26-74  AC Q0UP27.1
#=GS TOX1_PHANO/18-65    AC A9JX75.1
#=GS B2W296_PYRTR/29-78  AC B2W296.1
B2W548_PYRTR/18-65             ARNIMHLDK-.NSIEARTIYEPLAGGIGYRAYVDGSLCSCTECTPVDCTH
Q0UP27_PHANO/26-74             ASGLEIIQGK.ALLEARQRACFQNPGTGCRTFNNGNACCCWDCTEAQCNS
TOX1_PHANO/18-65               NEGILTFEG-.LGLARRQTICHTPGGSGCRASISGDQCCCTSCTPEDCSD
B2W296_PYRTR/29-78             ALKIIHADDHsSSLEARQGGCPVQEGTGCLTLRRGDLCCCSGCTVLDLRE
#=GC seq_cons                  ApsIhph-s..suLEARQthC.hssGoGCRshhsGshCCCosCTshDCsc
//
DBGET integrated database retrieval system