GenomeNet

Database: Pfam
Entry: CagA
LinkDB: CagA
Original site: CagA 
#=GF ID   CagA
#=GF AC   PF03507.16
#=GF DE   CagA exotoxin phosphopeptide substrate mimic region
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_918 (release 7.0)
#=GF GA   25.00 25.00;
#=GF TC   25.10 70.90;
#=GF NC   23.50 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Motif
#=GF RN   [1]
#=GF RM   19966800
#=GF RT   Helicobacter pylori CagA inhibits PAR1-MARK family kinases by
#=GF RT   mimicking host substrates.
#=GF RA   Nesic D, Miller MC, Quinkert ZT, Stein M, Chait BT, Stebbins CE;
#=GF RL   Nat Struct Mol Biol. 2010;17:130-132.
#=GF DR   INTERPRO; IPR005169;
#=GF DR   SO; 0001067; polypeptide_motif;
#=GF CC   Helicobacter pylori is the most common world-wide infection and
#=GF CC   plays an important role in pathogenesis of peptic ulcers. The
#=GF CC   CagA (cytotoxin-associated gene A) protein is a cell-surface
#=GF CC   antigen which may play a role in determining the relative
#=GF CC   virulence of the viral strains. This entry represents the
#=GF CC   phosphopeptide substrate mimic region of CagA [1].
#=GF SQ   2
#=GS CAGA_HELPY/940-978   AC P55980.1
#=GS CAGA_HELPY/940-978   DR PDB; 3IEC E; 948-961;
#=GS CAGA_HELPY/940-978   DR PDB; 3IEC H; 948-961;
#=GS CAGA_HELPY/940-978   DR PDB; 5X7B L; 970-976;
#=GS CAGA_HELPY/940-978   DR PDB; 5X94 L; 954-960;
#=GS CAGA_HELPY/940-978   DR PDB; 5X94 N; 950-960;
#=GS CAGA_HELPY/940-978   DR PDB; 5X94 O; 956-960;
#=GS CAGA_HELPY/940-978   DR PDB; 5X94 M; 955-960;
#=GS CAGA_HELPY/940-978   DR PDB; 3IEC F; 948-961;
#=GS CAGA_HELPY/940-978   DR PDB; 3IEC G; 948-961;
#=GS CAGA_HELPY/940-978   DR PDB; 5X7B N; 971-977;
#=GS CAGA_HELPY/979-1011  AC P55980.1
CAGA_HELPY/940-978              GGVGQAAGFPLKRHDKVDDLSKVGLSASPEPIYATIDDL
#=GR CAGA_HELPY/940-978   SS    XXXXXXXXXBXXXXXXBSXTTXXXXXXXXXXEEE-B--X
CAGA_HELPY/979-1011             GG-----PFPLKRHDKVDDLSKVGRSRNQE-LAQKIDNL
#=GC SS_cons                    XXXXXXXXXBXXXXXXBSXTTXXXXXXXXXXEEE-B--X
#=GC seq_cons                   GG.....sFPLKRHDKVDDLSKVGhSts.E.lhtpIDsL
//
DBGET integrated database retrieval system