GenomeNet

Database: Pfam
Entry: CagZ
LinkDB: CagZ
Original site: CagZ 
#=GF ID   CagZ
#=GF AC   PF09053.12
#=GF DE   CagZ
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF AU   Sammut SJ;0000-0003-4472-904X
#=GF SE   pdb_1s2x
#=GF GA   25.00 25.00;
#=GF TC   26.60 462.80;
#=GF NC   22.50 22.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   CagZ
#=GF RN   [1]
#=GF RM   15223328
#=GF RT   Crystal structure of CagZ, a protein from the Helicobacter
#=GF RT   pylori pathogenicity island that encodes for a type IV secretion
#=GF RT   system. 
#=GF RA   Cendron L, Seydel A, Angelini A, Battistutta R, Zanotti G; 
#=GF RL   J Mol Biol. 2004;340:881-889.
#=GF DR   INTERPRO; IPR015139;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   CagZ is a 23 kDa protein consisting of a single compact L-shaped
#=GF CC   domain, composed of seven alpha-helices that run antiparallel to
#=GF CC   each other. 70% of the residues are in alpha-helix conformation
#=GF CC   and no beta-sheet is present. CagZ is essential for the
#=GF CC   translocation of the pathogenic protein CagA into host cells
#=GF CC   [1].
#=GF SQ   1
#=GS O25261_HELPY/1-199  AC O25261.1
#=GS O25261_HELPY/1-199  DR PDB; 6JHO A; 2-199;
#=GS O25261_HELPY/1-199  DR PDB; 6JHO B; 2-199;
O25261_HELPY/1-199             MELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE
#=GR O25261_HELPY/1-199  SS    XT-SS-HHHHHHHHHHCCCCCTTHHHHHHHHHHHHTGGGGG--SHHHHHHHHHHHHHHHHHTT--CHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS-GGG--TT--HHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTTTS--HHHHHHHHHHHT----
#=GC SS_cons                   XT-SS-HHHHHHHHHHCCCCCTTHHHHHHHHHHHHTGGGGG--SHHHHHHHHHHHHHHHHHTT--CHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTS-GGG--TT--HHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHTTTTS--HHHHHHHHHHHT----
#=GC seq_cons                  MELGFNEAERQKILDSNSSLMGNANEVRDKFIQNYASSLKDSNDPQDFLRRVQELRINMQKNFISFDVYYNYLNNLVLASYNRCKQEKTFAESTIKNELTLGEFVAEISDNFNNFMCDEVARISDLVASYLPREYLPPFIDGNMMGVAFQILGIDDFGRKLNEIVQDIGTKYIILSKNKTYLTSLERAKLITQLKLNLE
//
DBGET integrated database retrieval system