#=GF ID   Clink
#=GF AC   PF19411.5
#=GF DE   Cell cycle link protein Clink
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Chakraborty Swati
#=GF GA   25.00 25.00;
#=GF TC   27.60 131.30;
#=GF NC   23.20 22.20;
#=GF BM   hmmbuild  HMM.ann SEED.ann
#=GF SM   hmmsearch --cpu 8 -Z 90746521 -E 1000 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   21161359
#=GF RT   Identification of a major pathogenicity determinant and
#=GF RT   suppressors of RNA silencing encoded by a South Pacific isolate
#=GF RT   of Banana bunchy top virus originating from Pakistan.
#=GF RA   Amin I, Ilyas M, Qazi J, Bashir R, Yadav JS, Mansoor S, Fauquet
#=GF RA   CM, Briddon RW;
#=GF RL   Virus Genes. 2011;42:272-281.
#=GF DR   INTERPRO; IPR045832;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This entry represents the cell cycle link protein Clink from 
#=GF CC   Banana bunchy top virus (BBTV) [1] which was identified as a
#=GF CC   suppressor of RNA silencing. It interacts with
#=GF CC   retinoblastoma-related proteins (pRB) and S-phase
#=GF CC   kinase-associated protein 1 (SKP1). Clink contains LxCxE and
#=GF CC   F-box motifs that mediate the interactions with the respective
#=GF CC   proteins and the capacity of Clink to bind pRB correlates with
#=GF CC   its ability to stimulate viral replication. pRB is a key cell
#=GF CC   cycle regulator, which represses onset and progression into
#=GF CC   S-phase by interacting with a wide range of cell cycle-related
#=GF CC   proteins.
#=GF SQ   2
#=GS CLINK_BBTVA/1-144   AC Q65389.1
#=GS B0LBX7_9VIRU/1-141  AC B0LBX7.1
CLINK_BBTVA/1-144              MEFWESSAMPDDVKREIKEIYWEDRKKLLFCQKLKSYVRRILVYGDQEDALAGVKDMKTSIIRYSEYLKKPCVVICCVSNKSIVYRLNSMVFFYHEYLEELGGDYSVYQDLYCDEVLSSSSteEEDVGVIyRNVIMASTQ----ekfs
B0LBX7_9VIRU/1-141             MEFWNSEAFCDDVKRVIKQKYWEERMKSLFIEKVSGYVRRILVYGNLDDTIYAVQQMKTSIVQCAERFGKACVVVYNGLDPSIGFRLHTMAFFFEEYVEEVSTADPMAVQLFCDEEIEEFS..NSDVRLI.KNVIMASTDASID....
#=GC seq_cons                  MEFWpSpAhsDDVKR.IKphYWE-RhK.LFhpKlpuYVRRILVYGs.-DslhuVppMKTSIlphuEhhtKsCVVlhss.s.SIsaRLpoMsFFacEYlEEluss.shh.pLaCDE.lpp.S..ppDVtlI.+NVIMASTp........
//