GenomeNet

Database: Pfam
Entry: CoV_NSP15_N
LinkDB: CoV_NSP15_N
Original site: CoV_NSP15_N 
#=GF ID   CoV_NSP15_N
#=GF AC   PF19219.2
#=GF DE   Coronavirus replicase NSP15, N-terminal oligomerisation
#=GF PI   Corona_NS15_N;
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF AU   Chuguransky S;0000-0002-0520-0736
#=GF SE   Bateman A
#=GF GA   27.00 27.00;
#=GF TC   27.60 74.80;
#=GF NC   23.10 22.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF DR   INTERPRO; IPR043606;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This is the N-terminal domain of the coronavirus nonstructural
#=GF CC   protein 15 (NSP15), which is encoded by ORF1a/1ab and
#=GF CC   proteolytically released from the pp1a/1ab polyprotein. NSP15,
#=GF CC   is a nidoviral RNA uridylate-specific endoribonuclease (NendoU)
#=GF CC   carrying C-terminal catalytic domain belonging to the EndoU
#=GF CC   family. The SARS-CoV-2 NendoU monomers assemble into a
#=GF CC   double-ring hexamer, generated by a dimer of trimers. The
#=GF CC   hexamer is stabilized by the interactions of N-terminal
#=GF CC   oligomerization domain.
#=GF SQ   77
#=GS E0XIZ2_9BETC/6421-6481      AC E0XIZ2.1
#=GS H9BZX5_9BETC/6507-6567      AC H9BZX5.1
#=GS V5TFR4_9GAMC/6003-6063      AC V5TFR4.1
#=GS A3EXI9_BCHK9/6292-6352      AC A3EXI9.1
#=GS D9J202_9ALPC/6033-6093      AC D9J202.1
#=GS A3EXE7_BCHK5/6523-6583      AC A3EXE7.1
#=GS S5YAF0_9ALPC/6187-6247      AC S5YAF0.1
#=GS A0A096XNJ3_9ALPC/6103-6163  AC A0A096XNJ3.2
#=GS R1AB_BCHK9/6297-6357        AC P0C6W5.1
#=GS F2YDB1_SARS/6430-6490       AC F2YDB1.1
#=GS A0A240FW17_9ALPC/5691-5751  AC A0A240FW17.1
#=GS A0A0U1WHD1_9ALPC/6251-6311  AC A0A0U1WHD1.1
#=GS A0A088DIE1_9BETC/6596-6656  AC A0A088DIE1.1
#=GS A0A0U1UZA8_9ALPC/6293-6353  AC A0A0U1UZA8.1
#=GS A0A0U1WHK4_SARS/6430-6490   AC A0A0U1WHK4.1
#=GS H9BQZ9_9NIDO/5672-5732      AC H9BQZ9.1
#=GS H9BR34_9NIDO/5603-5663      AC H9BR34.1
#=GS A0A1B3Q5W8_9BETC/6339-6399  AC A0A1B3Q5W8.1
#=GS E0ZN59_BCHK9/6272-6332      AC E0ZN59.1
#=GS A0A0K1RM35_9ALPC/2042-2102  AC A0A0K1RM35.1
#=GS A0A0K1YZY7_SARS/6430-6490   AC A0A0K1YZY7.1
#=GS A0A0U1UZ20_9ALPC/6258-6318  AC A0A0U1UZ20.1
#=GS A0A0K2RW65_9BETC/6453-6513  AC A0A0K2RW65.1
#=GS B6VDX7_THCOV/5681-5741      AC B6VDX7.1
#=GS A0A0U1WHG4_9ALPC/6102-6162  AC A0A0U1WHG4.1
#=GS A0A023YA54_MERS/6535-6595   AC A0A023YA54.1
#=GS A3EXA2_BCHK4/6476-6536      AC A3EXA2.1
#=GS T2B9U0_MERS/6433-6493       AC T2B9U0.1
#=GS A0A0P0LKV0_CVH22/6116-6176  AC A0A0P0LKV0.1
#=GS E0ZN51_BCHK9/6292-6352      AC E0ZN51.1
#=GS Q0PL13_9ALPC/2042-2102      AC Q0PL13.1
#=GS A0A0U1UZC3_9ALPC/6016-6076  AC A0A0U1UZC3.1
#=GS R1AB_BCHK5/6524-6584        AC P0C6W4.1
#=GS R1AB_FIPV/6071-6131         AC Q98VG9.2
#=GS R1AB_SARS2/6453-6513        AC P0DTD1.1
#=GS R1AB_SARS2/6453-6513        DR PDB; 6XDH A; 2-62;
#=GS R1AB_SARS2/6453-6513        DR PDB; 6W01 B; 2-62;
#=GS R1AB_SARS2/6453-6513        DR PDB; 6VWW B; 2-62;
#=GS R1AB_SARS2/6453-6513        DR PDB; 6XDH B; 2-62;
#=GS R1AB_SARS2/6453-6513        DR PDB; 6W01 A; 2-62;
#=GS R1AB_SARS2/6453-6513        DR PDB; 6VWW A; 2-62;
#=GS R1AB_CVM2/6452-6512         AC P0C6X8.1
#=GS B8Q8S4_SARS/6430-6490       AC B8Q8S4.1
#=GS U5KNA9_9BETC/6497-6557      AC U5KNA9.1
#=GS A0A0A7UXR0_9BETC/6465-6525  AC A0A0A7UXR0.1
#=GS C0KYZ7_9BETC/2061-2121      AC C0KYZ7.1
#=GS R9QTA1_SARS/1985-2045       AC R9QTA1.1
#=GS K4K1U5_9ALPC/6141-6201      AC K4K1U5.1
#=GS A8JNZ0_9ALPC/6085-6145      AC A8JNZ0.1
#=GS R1AB_CVPPU/6046-6106        AC P0C6Y5.1
#=GS A0A0U1WHG1_9ALPC/5959-6019  AC A0A0U1WHG1.1
#=GS Q0ZJB1_CVHK1/6509-6569      AC Q0ZJB1.1
#=GS Q6UZF5_SARS/6430-6490       AC Q6UZF5.1
#=GS R1AB_CVMA5/6504-6564        AC P0C6X9.1
#=GS H9AA60_9BETC/6439-6499      AC H9AA60.1
#=GS R1AB_IBVB/5990-6050         AC P0C6Y1.1
#=GS B2BW31_9GAMC/6003-6063      AC B2BW31.1
#=GS B8Q8U6_SARS/6430-6490       AC B8Q8U6.1
#=GS A3EXC0_BCHK4/6486-6546      AC A3EXC0.1
#=GS A0A0U2LWJ9_9ALPC/2042-2102  AC A0A0U2LWJ9.1
#=GS R1AB_BC279/6436-6496        AC P0C6V9.1
#=GS B1PHJ3_9ALPC/6294-6354      AC B1PHJ3.1
#=GS A0A0F6WGL5_9GAMC/6034-6094  AC A0A0F6WGL5.1
#=GS B1PHI6_9ALPC/6350-6410      AC B1PHI6.1
#=GS A0A125R5A3_9ALPC/6058-6118  AC A0A125R5A3.1
#=GS Q9J3E8_9BETC/2061-2121      AC Q9J3E8.1
#=GS Q9J3E8_9BETC/2061-2121      DR PDB; 2GTH A; 1-61;
#=GS Q9J3E8_9BETC/2061-2121      DR PDB; 2GTI A; 1-61;
#=GS R1AB_CVMJH/6508-6568        AC P0C6Y0.1
#=GS A0A0U1UZ65_BCHK4/6484-6544  AC A0A0U1UZ65.1
#=GS R1AB_SARS/6430-6490         AC P0C6X7.1
#=GS R1AB_SARS/6430-6490         DR PDB; 2RHB D; 1-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2H85 A; 1-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2RHB E; 1-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2RHB C; 1-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2RHB B; 1-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2RHB A; 1-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2OZK A; 27-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2OZK B; 28-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2RHB F; 1-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2OZK D; 29-61;
#=GS R1AB_SARS/6430-6490         DR PDB; 2OZK C; 29-61;
#=GS R1AB_CVH22/6111-6171        AC P0C6X1.1
#=GS R1AB_CVH22/6111-6171        DR PDB; 4RS4 A; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4RS4 F; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4RS4 C; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4S1T E; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4RS4 E; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4S1T B; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4RS4 B; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4S1T A; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4S1T D; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4S1T F; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4RS4 D; 1-61;
#=GS R1AB_CVH22/6111-6171        DR PDB; 4S1T C; 1-61;
#=GS A0A1X9JPE2_9ALPC/2024-2084  AC A0A1X9JPE2.1
#=GS H9BR16_9NIDO/5672-5732      AC H9BR16.1
#=GS H9BR24_9NIDO/5603-5663      AC H9BR24.1
#=GS A0A0U1WHG0_SARS/6425-6485   AC A0A0U1WHG0.1
#=GS B7U2N0_9BETC/2045-2105      AC B7U2N0.1
#=GS H9TEX0_9ALPC/6047-6107      AC H9TEX0.1
#=GS R1AB_BC512/6154-6214        AC P0C6W0.1
#=GS H9BR07_9NIDO/5648-5708      AC H9BR07.1
#=GS Q06BE0_9BETC/1970-2030      AC Q06BE0.1
#=GS B1PHK0_9ALPC/6258-6318      AC B1PHK0.1
#=GS R1AB_BCHK4/6476-6536        AC P0C6W3.1
#=GS R1AB_CVHOC/6422-6482        AC P0C6X6.1
#=GS A0A140ESF0_9NIDO/5662-5722  AC A0A140ESF0.1
E0XIZ2_9BETC/6421-6481                 SLENVAYNVVNKGHFDGQAGEKPVSIINNTVYTKVDGVDVEIFENKTTLPVNVAFELWAKR
H9BZX5_9BETC/6507-6567                 SLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKR
V5TFR4_9GAMC/6003-6063                 SLDQLVANVVKRDHFDDVKDDVPYVITGDKVFYRKGLQDVLIFENKTSMATSIAFEYYARR
A3EXI9_BCHK9/6292-6352                 SLENVAYNVLKSGHFMAVAGELPVAILNDRLYIKEDGVDKLLFTNNTCLPTNVAFELWAKR
D9J202_9ALPC/6033-6093                 SLENVAYNVVKKGVYTGLTGDLPTAIVADKVFVRDGSTDRVLFTNKTMLPTNVAFELYAKR
A3EXE7_BCHK5/6523-6583                 GLENIAYNVIKQGHFTGVEGELPVAVVNDKIYTKSDVNDVCIFENKTTLPTNIAFELYAKR
S5YAF0_9ALPC/6187-6247                 GLENIAFNVVKKGSFVGAEGELPVAIVGDKVLVRENDVDNLVFTNKTSLPTNVAFELYAKR
A0A096XNJ3_9ALPC/6103-6163             GLENLSYNLLKKGTFVNMPGELPTAIINDKVFVREGVADNLVFTNNTALPTNVAFELFVKK
R1AB_BCHK9/6297-6357                   SLENVAYNVLKSGHFTAVAGELPVAILNDRLYIKEDGADKLLFTNNTCLPTNVAFELWAKR
F2YDB1_SARS/6430-6490                  SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKR
A0A240FW17_9ALPC/5691-5751             ALERLAYNVVNSGYDKGLDGSLPVAIVNDRVIVKKDLEDIVVFENKTALPTNVAFELYVRR
A0A0U1WHD1_9ALPC/6251-6311             SLENVAFNVVKHGSFIGVDGELPVAIVSDKVFVREGTVDNVLFVNKTTLPTNVAFELYAKR
A0A088DIE1_9BETC/6596-6656             GLENVAYNVVNKGHFDGTQGEIPTAVIGDKVFVKREGVDVCVFTNNTTLPTNVAFELYAKR
A0A0U1UZA8_9ALPC/6293-6353             SLENVAFNVVKHGSFVGVKGDLPVAIVSDKVFVRDGVVDNVIFTNKTTLPTNIAFELYAKR
A0A0U1WHK4_SARS/6430-6490              SLENVAYNVVNKGHFDGQAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKR
H9BQZ9_9NIDO/5672-5732                 NLENLAYNCYYKNCNAHVDGQLDVVINNNAVYAKVDNNLVKLFDNRTNLPVSVAFEHYTNR
H9BR34_9NIDO/5603-5663                 TIENLAYNCYYKNYNAHNDGQLDVVVNNNAVYVKVNDNLVKLFDNKTNLPVSVAFEHYINR
A0A1B3Q5W8_9BETC/6339-6399             SLENVAYNVVKSSHYTAIPGELPVAIVNDKLYVKDEGYDKLLFTNKTCLPTNVAFELWAKR
E0ZN59_BCHK9/6272-6332                 SLENVAYNVLKSGHFTAIAGELPVAILNDRLYIKEDGVDKLLFTNNTCLPTNVAFELWAKR
A0A0K1RM35_9ALPC/2042-2102             SLENVAFNVVKKGAFTGLKGDLPTAVIADKIMVRDGPTDRCIFTNKTSLPTNVAFELYAKR
A0A0K1YZY7_SARS/6430-6490              SLENVAYNVVNKGHFDGQAGEAPVSIINNAVYTKVDGVDVEIFENKTTLPVNVAFELWAKR
A0A0U1UZ20_9ALPC/6258-6318             SLENVAFNLVKHGSFIGVDGELPVAIVSDKVFVREGTVDNVLFVNKTTLPTNVAFELYAKR
A0A0K2RW65_9BETC/6453-6513             SLENVVYNLVKTGYYTGQAGEMPCAIINDKVVAKIEQEDVVVFTNNTTYPTNIAVELFAKR
B6VDX7_THCOV/5681-5741                 NLENLAYNCYYKNCNAHVDGQLDVVINNNAVYAKVENNLVKLFDNRTNLPVSTAFEHYTNR
A0A0U1WHG4_9ALPC/6102-6162             GLENIAYNVIKKGSFVGEAGELPVAVVNDRVLVRDGTVDNLVFTNKTSLPTNVAFELYAKR
A0A023YA54_MERS/6535-6595              GLENIAYNVVKQGHFTGVDGELPVAVVNDKIFTKSGVNDICVFENKTSLPTNIAFELYAKR
A3EXA2_BCHK4/6476-6536                 GLENIAFNVIKQGHFTGVDGELPVAVVNDKIFTKNGTDDVCIFKNETALPTNVAFELYAKR
T2B9U0_MERS/6433-6493                  GLENIAFNVVKQGHFIGVEGELPVAVVNDKIFTKSGVNDICMFENKTTLPTNIAFELYAKR
A0A0P0LKV0_CVH22/6116-6176             GLENIAFNVVKKGSFVGADGELPVAINGDKVFVRDGNTDNLIFVNKTSLPTNIAFELFAKR
E0ZN51_BCHK9/6292-6352                 SLENVAYNVLKSGHFTAVAGELPVAIFNDRLYIREDGVDKLLFTNNTCLPTNVAFELWAKR
Q0PL13_9ALPC/2042-2102                 SLENVAFNVVKKGAFTGLKGDLPTAVIADKIMVRDGPTDRCIFTNKTSLPTNVAFELYAKR
A0A0U1UZC3_9ALPC/6016-6076             GLENIAFNVVKKGGFVGADGELPVAVVNDRVMVRDGMTDTLVFTNKTALPTNVAFELYAKR
R1AB_BCHK5/6524-6584                   GLENIAYNVIKQGHFTGVEGELPVAVVNDKIYTKSDVNDVCIFENKTTLPTNIAFELYAKR
R1AB_FIPV/6071-6131                    SLENVAFNVVKKGAFTGLKGDLPTAVIADKIMVRDGPTDKCIFTNKTSLPTNVAFELYAKR
R1AB_SARS2/6453-6513                   SLENVAFNVVNKGHFDGQQGEVPVSIINNTVYTKVDGVDVELFENKTTLPVNVAFELWAKR
#=GR R1AB_SARS2/6453-6513        SS    -HHHHHHHHHHHSS---------EEEETTEEEEEETTEEEEEEE--SSS-HHHHHHHHHTB
R1AB_CVM2/6452-6512                    SLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKR
B8Q8S4_SARS/6430-6490                  SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKR
U5KNA9_9BETC/6497-6557                 GLENIAFNVVKHGHFKGVEGELPVAVVNDKIFTKSGVNDVCVFENKTNLPTNVAFELYAKR
A0A0A7UXR0_9BETC/6465-6525             SLENVVYNLVKTGAFTGEAGEMPCAIRNDKVFAKIEQEDVLVFKNNTTFPTNVAVELFAKR
C0KYZ7_9BETC/2061-2121                 SLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVEVFKNNTPFPTNVAVELFAKR
R9QTA1_SARS/1985-2045                  SLENVAYNVINKGHFDGQTGETPVSIINNAVYTKVDGNDVEIFENKTTLPVNVAFELWAKR
K4K1U5_9ALPC/6141-6201                 SLENIAYNVIKKGSFVGESGELPVAIVNDKVFVREGTVDNLVFVNKTSLPANVAFELFAKR
A8JNZ0_9ALPC/6085-6145                 GLENIAYNVVKKGSFVGEPGELPVAVVNDRVSVRDGVSDNVIFVNKTSLPTNVAFELYAKR
R1AB_CVPPU/6046-6106                   SLENVAFNVVKKGAFTGLKGDLPTAVIADKIMVRDGPTDKCIFTNKTSLPTNVAFELYAKR
A0A0U1WHG1_9ALPC/5959-6019             GLENIAYNVVKKGSFVGASGELPVAVVNDRVLVREDLSDNVVFVNKTSLPTNVAFELYAKR
Q0ZJB1_CVHK1/6509-6569                 SLENVIYNLVNAGHYDGRIGELPCAIMNDKVVVKINNVDTVIFKNNTSLPTNIAVELFTKR
Q6UZF5_SARS/6430-6490                  SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKR
R1AB_CVMA5/6504-6564                   SLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKR
H9AA60_9BETC/6439-6499                 SLENVVYNLVKTGHYTGQTGEMPCAIINDKVVAKIEQEDVVIFTNNTTYPTNIAVELFAKR
R1AB_IBVB/5990-6050                    SIDNIAYNMYKGGHYDAIAGEMPTVITGDKVFVIDQGVEKAVFVNQTTLPTSVAFELYAKR
B2BW31_9GAMC/6003-6063                 SLDQPVANVVKRDHFDDVKDDVPYVITGDKVFYRKGLQDVLIFENKTSMATSIAFEYYARR
B8Q8U6_SARS/6430-6490                  SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKR
A3EXC0_BCHK4/6486-6546                 GLENIAFNVIKQGHFTGVDGELPVAVVNDKIFTKNGTDDVCIFKNETALPTNVAFELYAKR
A0A0U2LWJ9_9ALPC/2042-2102             SLENVAFNVVKKGAFTGLNGDLPTAVIADKIMVRDGPTDRCIFTNKTSLPTNVAFELYAKR
R1AB_BC279/6436-6496                   SLENVAYNVVNKGHFDGQIGEAPVSIINNAVYTKVDGNDVEIFENKTTLPVNVAFELWAKR
B1PHJ3_9ALPC/6294-6354                 SLENVAFNVVKHGSFVGVKGDLPVAIVSDKVFVRDGVVDNVIFTNKTTLPTNIAFELYAKR
A0A0F6WGL5_9GAMC/6034-6094             SIDNIAYNMYKRGHYDAVVGEIPTVVTGDKVFVIDKGIEKAVFVNQSTLPTSVAFELFAKR
B1PHI6_9ALPC/6350-6410                 SLENVAYNVVKHGSFKGVEGDLPVAIVSDKVFVRDGVVDNVIFTNKTTLPTNIAFELYAKR
A0A125R5A3_9ALPC/6058-6118             SLENVAFNVVKKGAFADLKGDLPTAVVADKIMVRDGPTDKCIFTNKTSLPTNVAFELYAKR
Q9J3E8_9BETC/2061-2121                 SLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAKR
#=GR Q9J3E8_9BETC/2061-2121      SS    -HHHHHHHHHHCSS---------EEEETTEEEEEETTEEEEEEE--SSS-HHHHHHHHHTB
R1AB_CVMJH/6508-6568                   SLENVVYNLVNAGHFDGRAGELPCAVIGEKVIAKIQNEDVVVFKNNTPFPTNVAVELFAER
A0A0U1UZ65_BCHK4/6484-6544             GLENIAFNVIKQGHFTGVDGELPVAVVNDKIFTKNGTDDVCIFKNETALPTNVAFELYAKR
R1AB_SARS/6430-6490                    SLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKR
#=GR R1AB_SARS/6430-6490         SS    XHHHHHHHHHHHSSXXSXXXXXXEEEETTEEEEEETTEEEEEEESTSSSBHHHHHHHHHTB
R1AB_CVH22/6111-6171                   GLENIAFNVVNKGSFVGADGELPVAISGDKVFVRDGNTDNLVFVNKTSLPTNIAFELFAKR
#=GR R1AB_CVH22/6111-6171        SS    HHHHHHHHHHHHSS---------EEEETTEEEEEETTEEEEEEE--SSS-HHHHHHHHHTB
A0A1X9JPE2_9ALPC/2024-2084             GLENLSYNLLKKGTFVNMPGELPTAIINDKVFVREGTADNLVFTNNTALPTNVAFELYVKK
H9BR16_9NIDO/5672-5732                 TLENLAYNCYYKNTNQHVNGSLDVIINNNTVSTVVDGKTVKLFENYTNLPVSVAFEHYTNR
H9BR24_9NIDO/5603-5663                 TLENLAYNVYYKNHNANVRGELDVVISNNVVSAKVDGRIIKLFENTTILPVSVAFEHYTNR
A0A0U1WHG0_SARS/6425-6485              SLENVAYNVINKGHFDGQIGEAPVSIINNAVYTKVDGVDVEIFENKTTLPVNVAFELWAKR
B7U2N0_9BETC/2045-2105                 SLENVVYNLVKTGHYTGQAGEMPCAIINDKVVAKIDKEDVVIFINNTTYPTNVAVELFAKR
H9TEX0_9ALPC/6047-6107                 SLENVAFNVVKKGAFAGLKGDLPTAVIADKIMVRDGPTDKCIFTNKTSLPTNVAFELYAKR
R1AB_BC512/6154-6214                   GLENIAYNVVKKGSFVGVEGELPVAVVNDKVMVRDGVSDNVVFVNNTSLPTNVAFELYAKR
H9BR07_9NIDO/5648-5708                 NLENLAYNCYYKNCNAHADGSLDVVINSNAVYAKVDNNLVKLFDNRTNLPVSVAFEHYTNR
Q06BE0_9BETC/1970-2030                 SLENVVYNLVKTGHYTGQAGEMPCAIINDKVVAKIDKEDVVIFINNTTYPTNVAVELFAKR
B1PHK0_9ALPC/6258-6318                 SLENVAFNVVKHGSFIGVDGELPVAIVADKVFVREGTVDNVLFVNKTTLPTNVAFELYAKR
R1AB_BCHK4/6476-6536                   GLENIAFNVIKQGHFTGVDGELPVAVVNDKIFTKNGTDDVCIFKNETALPTNVAFELYAKR
R1AB_CVHOC/6422-6482                   SLENVVYNLVKTGHYTGQAGEMPCAIINDKVVTKIDKEDVVIFINNTTYPTNVAVELFAKR
A0A140ESF0_9NIDO/5662-5722             NLENLAYNCYYKNCNAHVDGQLDVVINNNAVYAKVDNNLVKLFDNRTNLPVSVAFEHYTNR
#=GC SS_cons                           HHHHHHHHHHHHSS--S------EEEETTEEEEEETTEEEEEEESTSSSBHHHHHHHHHTB
#=GC seq_cons                          SLENlAYNVVK+GpFsGhsGELPVAIlNDKVas+ssssDshlFpN+ToLPTNVAFELaAKR
//
DBGET integrated database retrieval system