GenomeNet

Database: Pfam
Entry: CsgA
LinkDB: CsgA
Original site: CsgA 
#=GF ID   CsgA
#=GF AC   PF17334.5
#=GF DE   Minor curli fiber component A
#=GF AU   El-Gebali S;0000-0003-1378-5495
#=GF SE   PRODOM:PD059965
#=GF GA   25.00 25.00;
#=GF TC   30.30 73.60;
#=GF NC   23.80 23.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   25620560
#=GF RT   The bacterial curli system possesses a potent and selective
#=GF RT   inhibitor of amyloid  formation.
#=GF RA   Evans ML, Chorell E, Taylor JD, Aden J, Gotheson A, Li F, Koch
#=GF RA   M, Sefer L, Matthews SJ, Wittung-Stafshede P, Almqvist F,
#=GF RA   Chapman MR;
#=GF RL   Mol Cell. 2015;57:445-455.
#=GF RN   [2]
#=GF RM   21877724
#=GF RT   Fibrillation of the major curli subunit CsgA under a wide range
#=GF RT   of conditions implies a robust design of aggregation.
#=GF RA   Dueholm MS, Nielsen SB, Hein KL, Nissen P, Chapman M,
#=GF RA   Christiansen G, Nielsen PH, Otzen DE;
#=GF RL   Biochemistry. 2011;50:8281-8290.
#=GF DR   INTERPRO; IPR020255;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Curli are extracellular functional amyloids that are assembled
#=GF CC   by enteric bacteria during biofilm formation and host
#=GF CC   colonization. The csg (curli specific gene) operon encodes major
#=GF CC   structural and accessory proteins that are required for curli
#=GF CC   production. The csgBAC operon encodes the major and minor curli
#=GF CC   fiber components, CsgA and CsgB, respectively. CsgA is secreted
#=GF CC   to the extracellular milieu as an unfolded protein and forms
#=GF CC   amyloid polymers upon interacting with the CsgB nucleator [1].
#=GF CC   CsgA is comprised of five imperfect repeating units with highly
#=GF CC   conserved glutamine and asparagine residues that are important
#=GF CC   for amyloid formation. Each repeating unit is predicted to form
#=GF CC   a strand-loop-strand motif [2]. In vitro, CsgC inhibits CsgA
#=GF CC   amyloid formation at substoichiometric concentrations and
#=GF CC   maintains CsgA in a non-beta-sheet rich conformation, making
#=GF CC   CsgC an efficient and selective amyloid inhibitor [1].
#=GF SQ   101
#=GS A0A1H8HLK2_9BACI/1-83    AC A0A1H8HLK2.1
#=GS A0A372LJ01_9BACI/1-83    AC A0A372LJ01.1
#=GS A0A437K3T3_9BACI/1-82    AC A0A437K3T3.1
#=GS A0A167UX58_9BACI/1-84    AC A0A167UX58.1
#=GS A0A6M0Q466_9BACI/1-83    AC A0A6M0Q466.1
#=GS A0A223KQF1_9BACI/1-84    AC A0A223KQF1.1
#=GS A0A1L8ZS94_9BACI/1-81    AC A0A1L8ZS94.1
#=GS A0A5R9F806_9BACI/1-84    AC A0A5R9F806.1
#=GS A0A1S2QRA5_9BACI/1-83    AC A0A1S2QRA5.1
#=GS A0A075JLN9_9BACI/1-82    AC A0A075JLN9.1
#=GS W4QSG6_BACA3/1-83        AC W4QSG6.1
#=GS A6CMP3_9BACI/1-83        AC A6CMP3.1
#=GS A0A498DB16_9BACI/1-82    AC A0A498DB16.1
#=GS W9AIS8_9BACI/4-85        AC W9AIS8.1
#=GS CSGA_BACSU/1-82          AC P54379.1
#=GS A0A1I0DPR2_9BACI/1-83    AC A0A1I0DPR2.1
#=GS A0A179T171_9BACI/1-82    AC A0A179T171.1
#=GS A0A1V2SGC7_9BACI/1-82    AC A0A1V2SGC7.1
#=GS A0A268I956_9BACI/1-83    AC A0A268I956.1
#=GS A0A1H0TJ89_9BACI/1-83    AC A0A1H0TJ89.1
#=GS A0A1X9MB75_9BACI/1-83    AC A0A1X9MB75.1
#=GS W1SGJ9_9BACI/1-83        AC W1SGJ9.1
#=GS A0A494Z859_9BACI/1-82    AC A0A494Z859.1
#=GS A0A1S2LH90_9BACI/1-83    AC A0A1S2LH90.1
#=GS A0A0M3REH2_9BACI/1-82    AC A0A0M3REH2.1
#=GS A0A161HUP7_9BACI/1-84    AC A0A161HUP7.1
#=GS A0A2N5LZE2_9BACI/86-168  AC A0A2N5LZE2.1
#=GS A0A0N0Z5T5_9BACI/1-84    AC A0A0N0Z5T5.1
#=GS A0A1H9YDU6_9BACI/4-85    AC A0A1H9YDU6.1
#=GS A0A0M3RA12_9BACI/1-82    AC A0A0M3RA12.1
#=GS A0A2N5H3J6_9BACI/1-83    AC A0A2N5H3J6.1
#=GS A0A1H1E4N9_9BACI/1-78    AC A0A1H1E4N9.1
#=GS A0A6N8FJH3_9BACI/1-82    AC A0A6N8FJH3.1
#=GS A0A549YMX5_9BACI/1-82    AC A0A549YMX5.1
#=GS A0A0K0GAX1_9FIRM/1-82    AC A0A0K0GAX1.1
#=GS A0A3A1QSL3_9BACI/1-83    AC A0A3A1QSL3.1
#=GS A0A398B6Z7_9BACI/1-83    AC A0A398B6Z7.1
#=GS A0A5J5HVG0_9BACI/1-83    AC A0A5J5HVG0.1
#=GS A0A150L882_9BACI/1-82    AC A0A150L882.1
#=GS A0A2A8IF08_9BACI/1-83    AC A0A2A8IF08.1
#=GS A0A2C1YXB6_9BACI/1-83    AC A0A2C1YXB6.1
#=GS A0A0H4KJD5_9BACI/1-83    AC A0A0H4KJD5.1
#=GS E6TRA0_BACCJ/1-83        AC E6TRA0.1
#=GS A0A0U1P059_9BACI/1-83    AC A0A0U1P059.1
#=GS A0A4R2P710_9BACL/6-88    AC A0A4R2P710.1
#=GS A0A2N0Z0F1_9BACI/1-66    AC A0A2N0Z0F1.1
#=GS A0A1L3MQM3_9BACI/1-82    AC A0A1L3MQM3.1
#=GS A0A3S0J1J4_9BACI/1-83    AC A0A3S0J1J4.1
#=GS A0A7H8SAR7_9BACI/1-82    AC A0A7H8SAR7.1
#=GS C5D318_GEOSW/1-84        AC C5D318.1
#=GS A0A0A8X464_9BACI/1-83    AC A0A0A8X464.1
#=GS A0A098EYJ9_9BACI/1-82    AC A0A098EYJ9.1
#=GS A0A1Q9PZV7_9BACI/1-84    AC A0A1Q9PZV7.1
#=GS A0A2N6RMN1_9BACI/1-82    AC A0A2N6RMN1.1
#=GS A0A268JKQ8_9BACI/1-83    AC A0A268JKQ8.1
#=GS A0A1S2QWE6_9BACI/1-84    AC A0A1S2QWE6.1
#=GS A0A433HNN7_9BACI/1-83    AC A0A433HNN7.1
#=GS A0A495A2Z4_9BACI/1-82    AC A0A495A2Z4.1
#=GS A0A090IX23_9BACI/1-83    AC A0A090IX23.1
#=GS A0A1B9AS66_9BACI/1-83    AC A0A1B9AS66.1
#=GS A0A0Q3TK31_9BACI/1-81    AC A0A0Q3TK31.1
#=GS A0A1S2KZF5_9BACI/1-83    AC A0A1S2KZF5.1
#=GS A0A516KG73_9BACI/1-83    AC A0A516KG73.1
#=GS A0A562QQY9_9BACI/1-83    AC A0A562QQY9.1
#=GS A0A398B1S6_9BACI/1-83    AC A0A398B1S6.1
#=GS A0A0B0HQ44_9BACI/1-84    AC A0A0B0HQ44.1
#=GS A0A1S2LNC4_9BACI/1-83    AC A0A1S2LNC4.1
#=GS A0A3R9UB87_9BACI/1-82    AC A0A3R9UB87.1
#=GS A0A3T0I6S1_9BACI/1-83    AC A0A3T0I6S1.1
#=GS A0A327S4D0_9BACI/1-82    AC A0A327S4D0.1
#=GS N0AP63_9BACI/1-83        AC N0AP63.1
#=GS A0A084H087_METID/1-83    AC A0A084H087.1
#=GS A0A1I0Z749_9BACI/4-85    AC A0A1I0Z749.1
#=GS A0A0B0IK53_9BACI/1-83    AC A0A0B0IK53.1
#=GS A0A3E2JEI7_9BACI/1-83    AC A0A3E2JEI7.1
#=GS Q65P23_BACLD/1-82        AC Q65P23.1
#=GS B7GJQ6_ANOFW/4-87        AC B7GJQ6.1
#=GS A0A1M5HU80_9BACI/3-84    AC A0A1M5HU80.1
#=GS A0A4R2BEP7_9BACI/1-83    AC A0A4R2BEP7.1
#=GS A0A0M2SVS8_9BACI/1-83    AC A0A0M2SVS8.1
#=GS A0A0A6VJ57_9BACI/1-82    AC A0A0A6VJ57.1
#=GS Q5KXZ0_GEOKA/1-84        AC Q5KXZ0.1
#=GS A0A3D8GQ27_9BACI/1-82    AC A0A3D8GQ27.1
#=GS A0A4Y9ABV1_9BACI/1-82    AC A0A4Y9ABV1.1
#=GS A0A024QF10_9BACI/1-71    AC A0A024QF10.1
#=GS A0A077J3F7_9BACI/1-83    AC A0A077J3F7.1
#=GS A0A0M1NV99_9BACI/1-83    AC A0A0M1NV99.1
#=GS U5L6L8_9BACI/1-83        AC U5L6L8.1
#=GS W4PXR0_9BACI/1-83        AC W4PXR0.1
#=GS K6CYJ8_9BACI/5-87        AC K6CYJ8.1
#=GS A0A6G1X4E3_9BACI/1-83    AC A0A6G1X4E3.1
#=GS A0A385NV71_9BACI/1-83    AC A0A385NV71.1
#=GS A0A2N5MHB0_9BACI/11-91   AC A0A2N5MHB0.1
#=GS A0A268E269_9BACI/1-82    AC A0A268E269.1
#=GS A0A327JG00_9RHIZ/1-81    AC A0A327JG00.1
#=GS A0A4S4C4R6_9BACI/1-82    AC A0A4S4C4R6.1
#=GS A0A1H0DXK4_9BACI/1-83    AC A0A1H0DXK4.1
#=GS A0A4Q0VMQ5_9BACI/1-83    AC A0A4Q0VMQ5.1
#=GS A0A371SGT3_9BACI/1-82    AC A0A371SGT3.1
#=GS A0A2C1K4H3_9BACI/1-82    AC A0A2C1K4H3.1
#=GS A0A327YM86_9BACI/1-84    AC A0A327YM86.1
A0A1H8HLK2_9BACI/1-83               ..MEKTLAYLREILANYTEKDEIS.NRIYNKIEAGSYSSEGELVRDLTFEESEYLNGILPWEIKYAKNEQDEQRAYQLNEVYELLF.
A0A372LJ01_9BACI/1-83               ..MDRTIGYLREILSNYTDQYPEA.QQIYDKIKHGSFPTEEALVNDLNHGERALLNQILPEEINHAKEVQDDERYIQLNEVYELL-p
A0A437K3T3_9BACI/1-82               ..MIQSIAYVREVLSLYTDRSDTG.KSIYGKMKN-GYKSEEAFVRDLTEEEINFLNQVLAEEIQHAENEQDSERVHHLNDIYELLF.
A0A167UX58_9BACI/1-84               ..METTLAYLREALSNYLDYHNDIpSHIYHKLLEKPYANEEEFVRHLSQKEAAFLNHILPHEIHYAMNEQDMKRAHQLNEVYEQLL.
A0A6M0Q466_9BACI/1-83               ..MDTTLAYLREILSNYTDEYAIS.RTIYEKLKSSLNEGELSFIRALDQEEAQFLNKILPEEIQYALEEQDYTRMTELNHVYELLI.
A0A223KQF1_9BACI/1-84               ..MNKPLAYLREVLSNYTNEGQHYpSQLLSKIANNHYNTERDFVLDLSEQEIQYLNSILPNELSNAMESEDFPRVQQLNEVYELLF.
A0A1L8ZS94_9BACI/1-81               ..MDTTLAYLRESLSNHVN-RSTG.QRIYKKLQ-NHYQNEEEFVRDLDEEEISFLNSILKDEISYAQNEKDEKRVHQLNEVYELLI.
A0A5R9F806_9BACI/1-84               ..MDKTLAYLRESLSNWTKSEEIIvESINSKLENNHYKNEVTFLEDLSEEEAGFLTRILENEVKYADDQHDSIRKRELMNIYELL-t
A0A1S2QRA5_9BACI/1-83               ..MDQTLGYLREILSGHTDSDHAG.KILYHKLVKNNYKNEEAFVRDLSSSEGDYLNKVLKEAIDYSEQEGDSERAGQLNEVYELLI.
A0A075JLN9_9BACI/1-82               ..MDYTLDYLRESLANYAE-NEMC.QQIFQKLDENNYSNEEMFVRALDEEEMTYLNDVLENELHYAKSVEHDQRVKELTEVYELLF.
W4QSG6_BACA3/1-83                   ..MDSNLAFLRESLSNHTDNHKIC.QRIYQKLEQNHYANEEEFVKDLEENEATILNLVLQYELDYARNEQDDVRVQQLNGVYELLL.
A6CMP3_9BACI/1-83                   ..MDQNLAYLREVLSNYTEENEMM.SEIYRKIEHGHYPSEGAFVKGLSEEEIRSLENILDNEINHANEAGDLERGYQLNGVYELLY.
A0A498DB16_9BACI/1-82               ..MDKTLRYLRESLSNYSE-NEVC.RQILEKLRANQYAGEKQFVDDLSESEMEYLDNVLDNELNYAKNVENDLRVQELTEVYELLF.
W9AIS8_9BACI/4-85                   ..IDHTLDYLRESLANYQE-NEMC.QQIINKLQAKTYAGEGEFVKDLEDGEMTYLHDVLENELDYAKNVQYDQRVKELTEVFELLF.
CSGA_BACSU/1-82                     ..MDVTLGYLRESLSNHLE-NEVC.QRICKKMLAKRYANEEEFVKDLDDNEMSFLNHVLEKEIKYAQNEQDQKRAKELNEVYELLL.
A0A1I0DPR2_9BACI/1-83               ..MDQSLTYLQEVLSNYTEEIDAI.RDIDEKISTNQYPSENLFSRDLDEEESRILREIILKEIHHANESGDHERGYQLHEVYELLY.
A0A179T171_9BACI/1-82               ..MDFTLGYLTEAISNYDS-SSVA.KRISLKLEKGQFKTERDLVLTLDEDEIQFLNNVLPDEIKYAFNEQDFIRGNQLNEVYELLI.
A0A1V2SGC7_9BACI/1-82               ..MDHTLGYLRETMSNYDD-EEFG.RQIYKKLVSQHYKNEKEFVEKLGEEETDYLNSVLKEELKYARQAQDEKRLKELNEVYERL-t
A0A268I956_9BACI/1-83               ..MNQSLGYLKEILSNYTDRSDLC.KEIYAMIKRNDFISEESFVQELTSEQIDYLNKILPDEINHAREVNDSKRVEQLNEIFELLY.
A0A1H0TJ89_9BACI/1-83               mi--EALGYLRESISNYSDEQKDA.LSIQNKINENRYESETMFIRDLTEDEISFLNNILPDEINYAMNEKDYKRVNELNEVYELLY.
A0A1X9MB75_9BACI/1-83               ..MDTNLAFLRESLSNHLENHQIC.QRIYNKLENNQYMNEDEFVRDLEDNEATILNLILQYELDYAKNEQDEERVKQLNGIYELLI.
W1SGJ9_9BACI/1-83                   ..MDKTLGYLREILANYTDEHTEG.RHLYRKLLEGHYASEGAFVRELSQKESHFLNKILPTEINYAKEEQDEKRAYELNEVYELLF.
A0A494Z859_9BACI/1-82               ..MDNTLKYLRESLSNYSE-NELC.RQILNKMESRQYSSEGKFVRDLDEEEMAYLDNVLDNELNYAKNVQNDVRVRELTEVYELLF.
A0A1S2LH90_9BACI/1-83               ..MDVTLGYLRESLSNYTEKYESC.QQIYDKLKENQYKDEGEFVNDLNEAEIAVLDLVLKNEINYAKKEQDEKRAHELSEVYELLF.
A0A0M3REH2_9BACI/1-82               ..MDQSLQYLREIVSNYTEGHGQG.KRIYDLL-EKNYSSEEEFVSSLSEKDIQFLNTILPEEINYARDEQDDTRAEHLNNVFEQLI.
A0A161HUP7_9BACI/1-84               ..MEPTLAYLREVLSNYLDSHTSIpRHIYQKIVTKPYPNEEAFVRDLSQQEIAFLDRILPREIRYALNEQDTVRAHHLNEVYELLF.
A0A2N5LZE2_9BACI/86-168             ..MDQSLGYLREILAGHTENDAVG.KRLYDLVSKRNFSTDGAFVDELTAEENDYLNNILNEAIDYSKQEGDLERAKHLNEVYELLL.
A0A0N0Z5T5_9BACI/1-84               ..MEQTLAYLREVLSNYLDHHGDTpKRIYKKLISKPYRGEGEFVRDLTQEESAFLDRILPHEIRYAMDERDYERVYQLNEVYELLI.
A0A1H9YDU6_9BACI/4-85               ..IDQTLLYLRESLANYSE-NDLC.KGIYEKLEANQYESEEEFVQNLSDKEMAYLDSLVERELNYAKNVGDETRVDELTEVYELLF.
A0A0M3RA12_9BACI/1-82               ..MDKTLGYLRESMSNYLD-SDVC.QKIYKKMLAKHYSNEEEFVKDLNDEEMDFLDHVLGKEIKYAQDEQDHQRSRELNEVYELLF.
A0A2N5H3J6_9BACI/1-83               ..MDQTLGYLREILANYTEEYPVS.KHLYDRIDRQAFSSEGEFVRTLSYEESRFLNHILQEEIRYSNEERDEIRARQLNEVYELLI.
A0A1H1E4N9_9BACI/1-78               ..----MNYLRESLANYSG-NDMC.QKIDKKLETEVYKNEVEFVRDLDEEEMAYLDSVLKNELAYARNVENDIRVKELTEVYELLF.
A0A6N8FJH3_9BACI/1-82               ..MDNTLLYLRESLANYIE-NDLC.KEIYRKIESNHYESEEEFIEDLDDKEMAYLDSLLERELNYAKNVGDDTRIDQLTEVFELLF.
A0A549YMX5_9BACI/1-82               ..MDNTLHFLRESLANTSE-NAMT.KQIIARLEANDFTNEEEFVKSLSEEEMAYLDRVVGKELNYAQNAEDDVRAKQLNEVYELLF.
A0A0K0GAX1_9FIRM/1-82               ..MDNTLRYLRESLSNYSE-NEVC.QHIIKKIEQNHYKSEKEFVDDLEESEVAYLDNVLENELNYAKNVQNDERVQQLTEVFEILF.
A0A3A1QSL3_9BACI/1-83               ..MDQNLAYLREVLSNYTEENRMM.REIYEKIEHGHYPSEDAFVRALSEEEVRSLENILDNEINHANEAGDLERGYQLNEVYELLY.
A0A398B6Z7_9BACI/1-83               ..MDKTLAYLRETMANYTEKDPIA.DRIYRKIESEKYGSEGDFVQDLTFKEERYLNKVLEWEIQYAKNEQDEIRAKQLNEVFELLL.
A0A5J5HVG0_9BACI/1-83               ..MDQSLEYLREILSGHTENDQVG.KNLYAKICSHQYASEGKFVRELTQEENDYLNQILTEAIDYSKQEKDYVRARHLNEVYELLL.
A0A150L882_9BACI/1-82               ..MDTTLAYLRESLSNHLN-HSIG.EEIYKKLQANTNQNEMEFVRTLSEEETAFLNSVLEKEIRYAQDEQDQIRVTQLNEVYELLI.
A0A2A8IF08_9BACI/1-83               ..MDQTLGYLRETLSNYTDDHSNG.KNIYRKLMEGQYSSEGEFVRQLDQKEINFLNKMLPEEIKYAKDEKDEKRAHELNEVFELLF.
A0A2C1YXB6_9BACI/1-83               ..MDNTLAYLKEILSNYTDDHSEG.RFIYKKLIEGTYKSEGPFVRDLTQKEIHFLNNILPKEINHAKEAQDEKRAYQLNEVYELLL.
A0A0H4KJD5_9BACI/1-83               ..MEQSLKYLREILAAHVDRDVLG.RTIYERLSTYEYETEEAFVEDLTTKESHYLNAILTEAIDYSNQEQDKERARQLSDIYEVLF.
E6TRA0_BACCJ/1-83                   ..MDVSLRYLLESLSNYIDDDEEA.NEVYVKLKRNSFKNEKDFSKSLSTREIEKMNQIIKNEIHYANEENDEKRSKELNEVYENLF.
A0A0U1P059_9BACI/1-83               ..MDQTLGYLRETLSNYNDEHSVG.RNLYRKLSEGHFKTEGSFVRHLNQKEIDFLNKILPVEINYAKEEQDQKRAHELNEVFELLF.
A0A4R2P710_9BACL/6-88               .d-DHTLDYLMESLSNWIDDDVKA.VSLYRQLVAGHYPDEKAFVESLSEEEQLYLNGILTKEMDYAKTGQDDVRLTQLNEVYERLF.
A0A2N0Z0F1_9BACI/1-66               ..MNESLRYIREILSLYTDRSDIG.KTIPSKAENGSYKTEENFVRDLSPKEIDFLNNISKEESQYAKKE-----------------.
A0A1L3MQM3_9BACI/1-82               ..MDFTLGYLREALSNYE-RSSVC.ERIVGKLGEQSFTSEVEFVRILDEDEIQFLNNILPDEIKYAFDEQDFIRGNQLNEVYEQLI.
A0A3S0J1J4_9BACI/1-83               ..MNQPLGYLKEILSNYTDRSDIG.KEIYAIIREDDFTSEESFVSRLSNEQIDFLNKILPDEISHAQEEDDGERVMQLNEVHERLY.
A0A7H8SAR7_9BACI/1-82               ..MDNTLSYLRESLVNHQE-NDMT.KQIADKLERNGYKNEEEFVRNLNEEEMEYLDQVVKKELNYARNAEDEVRAGQLREIYELLF.
C5D318_GEOSW/1-84                   ..MEKTLAYLREILSNYTEYHDDTpRRIYKKLLSKPYKSEGEFVRDLSQKEAAFLDRILPHEIRYAMDERDFERVYQLNEVYELLI.
A0A0A8X464_9BACI/1-83               ..MEKTQAYLREIISNYTETYPLS.KKIYQRLEQGGYPSEGDFVRDLTAEEIEFLNKILPEAIEYAKNELDEKRAQQLNEVYELLY.
A0A098EYJ9_9BACI/1-82               ..MDQTLAYLREIVSNYTESHGEG.KQVYGHLQSFR-GSELDFIKKLSQKEIRFLNEILPEEIKYALDEQDEKRAMELNSVYEQLI.
A0A1Q9PZV7_9BACI/1-84               ..MDQTLKYLREILSNYTDEHHPTgRHIYRKLADGDFHSEGDFVRKLTQNEIEFLNKILPNEIKHAQEEQDDKRAYELNEVFELLF.
A0A2N6RMN1_9BACI/1-82               ..MDFTLGYLRESLSNY-DRSSVC.KRITNKLTHGTFHSELDFVRILDEDEIQFLNNVLPDEIKYAFNEQDFIRGNQLNEVYELLI.
A0A268JKQ8_9BACI/1-83               ..MDKTLGYLREILSNYSDQHSEG.KQLYRKLSEGKFSSEGDFVRQLSQKEIDFLNEMLPQEINYAKEEQDKKRAHELNEVFELLF.
A0A1S2QWE6_9BACI/1-84               ..MDKTLGYLREILSNYNDEHHSLgRHLFRKVSEGRFASEGDFVRLLDQKEIEFLNDILPKEIRYAKEEQDEKRAHELNEVYELLF.
A0A433HNN7_9BACI/1-83               ..MNQPLGYLLEILSAHTDNEAIG.KKLYDKISNKHYSTEGLFVRNLTAEEMDYLDKILTEAIDYSNQEQDYERVRQLNEVYELL-t
A0A495A2Z4_9BACI/1-82               ..MDKTLKYLRESLANYSE-NEIC.QHILRKLEQKEYKSEEQFVEDLDEEEIAYLDNVLENELNYAKNVQNDERVEQLTEVFELLF.
A0A090IX23_9BACI/1-83               ..MEQSLLYVREVLAPHTENSNVG.KSLFKKITKGNYASEEQFIRDLSEDESKFLNQVLKEAIDYSSQEQDSERARQLNDVYELLF.
A0A1B9AS66_9BACI/1-83               ..MNQSLGYVKEILSAHTEDSKVG.KHIYNMISDGNYDSGEQFVRDLSVGESHYLNRVLQNAIAYSNQEQDEERSKHLNEIYELLF.
A0A0Q3TK31_9BACI/1-81               ..MDVTLGYLRETLSNHLN-RGVG.QQIYKKLVNHQYKSEGDFVRDLNEGEIAFLNTILEKELRYAMEEQDEKRVKELNEVYELL-.
A0A1S2KZF5_9BACI/1-83               ..MDVTLGYLRESLSNYTEKYPSC.QRIYNMLKENHYQNEGEFVNDLNEAEIAVLDLVLKNEINYAKKEQDEKRAHELSEVYELLF.
A0A516KG73_9BACI/1-83               ..MDQNLQYLHEVLSNYTESHQAV.YDIDQNMMEHGYSSEELFVRNLTEEQSRILREIISKEMNHASESGDFERSYQLNRVFEILY.
A0A562QQY9_9BACI/1-83               ..MDQQLAYVRESLSNHIDDHQIC.ANIYKKLESRSYNNEEEFVRDLTENETAILNLVLRYEMDYARFEQDDNRVAQLNSIYEQLL.
A0A398B1S6_9BACI/1-83               ..MDQSLGYLREILAGYTENDTMG.KRIFDKISNRDYATEGKFVEDLTQAESNYLNRVLVDAIKYAKQEQDDERAHQLNEVYELLF.
A0A0B0HQ44_9BACI/1-84               ..MNQTLAYLREALANYADRHHTIaVHLYKKLMSKSYKNEEQFVRDLSQKEATFLDRMLRQEMKYAKEEQDAVRVHHLNEIYEQLI.
A0A1S2LNC4_9BACI/1-83               ..MDVTLGYLRESLSNYTEKYESC.QGIYQKLKENQYKNEGDFVDDLNEAEMAVLDLVLKNEIQYAKNEQDKKRAHELSEVYELLF.
A0A3R9UB87_9BACI/1-82               ..MDKTLLYLREILSNYNETSSLV.NGIYDKLSD-TFQSEGAFVRTLSEEESQILGDILPKEIKHAMEAQDYKRMHELNEVYELLF.
A0A3T0I6S1_9BACI/1-83               ..MDRTLGYLRETLSNYTDDHTEG.RHLYEKLTEGQYKSEGAFVRSLNQKEIDFLNKILHAEINYAQDVQDDRRVYELNEVYELLF.
A0A327S4D0_9BACI/1-82               ..MDYTLDYLKEALSNYEQ-NTIC.QEISKKMESEHFKNEGEFVLALTDDEIQFLNNVLPDEIKYSFNEQDYTRGNQLNEVYELLI.
N0AP63_9BACI/1-83                   ..MDKTLGYLRETLSNYTEQYSIG.QEIYNKLKEHNFKSEGSFVRALSQEESDFLNRILPDEINYANEEQDSLRSKQLNEVFELLF.
A0A084H087_METID/1-83               ..MEQSLSYLREALSNYLEEHETS.RHIYFKLSRESFTDEKQFIRMLSEKEQMFLNKMLPYEIKHAMGEQDYVRMNQLNDVYEEL-l
A0A1I0Z749_9BACI/4-85               ..IDSTLNYLRESLVNHRD-NDMT.KQIEDKLQTNDFRNEEEFVKSLDQEEIEYLDSVVEQELNYARNAEDDVRVKQLREIYALLF.
A0A0B0IK53_9BACI/1-83               ..MDSNLGYLRESLSNHLDNHQIC.QRIYHKLETKQYKDEDEFVRDLEDNEATILNLVLQYELDYARNEQDEKRVEQLNGVYELLI.
A0A3E2JEI7_9BACI/1-83               ..MNQSLAYVREILAGHTDIEPVG.QKIFDKISNKDYPTERLFVKNLTADEMYYLNRILEQAIEYSNQEQDYERSKHLNEVYELLM.
Q65P23_BACLD/1-82                   ..MDTTLGYLRESLSNHLE-HGIG.QNIYRKIVSGRYANEEEFVEHLEEREMEFLNQVLEHEMKYALNEQDHKRTRELNEVYELLF.
B7GJQ6_ANOFW/4-87                   ..LNQTLAYLREALANYADRHHAVaIHLYKKLISKPYKNEEQFVCDLSPKEVAFLDRMLRQEMKYAKEEQDNIRIYHLNEVYEQLI.
A0A1M5HU80_9BACI/3-84               ..IDNTLLYLRESLSNYLE-HDLC.KEIYNKMESNQYENEEAFVNDLDDKELSYLESLVERELSYANNVGDGTRIYQLNEVYELLF.
A0A4R2BEP7_9BACI/1-83               ..MEKTLAYLRETLSNYTEKDPVS.VTLMNMIENGNYSSEGALVRDLTFEQNDYLNKILQWEIEYAKNEQDEQRARQLNEVFELLF.
A0A0M2SVS8_9BACI/1-83               ..MEQTIAYLREILANYTEKDDVS.VGIYRKIEKGSYASEGALVNDLTFEESEYLNKILPWEIQYAKNEQDEQRAYQLNEVYELLF.
A0A0A6VJ57_9BACI/1-82               ..MDKTLGYLRESLSNHLE-NHIG.QSIYRKIISNHYSGEGEFVKDLDENEISYLNGVLKREINYAKREQDHKRTHELNEVYELLF.
Q5KXZ0_GEOKA/1-84                   ..MEQTLAYLREVLSNYLDHHGDTpKRIYKKLISKPYRGEGEFVRDLTQEESAFLDRILPHEIRYAMDERDYERVYQLNEVYELLI.
A0A3D8GQ27_9BACI/1-82               ..MDQSLAYLREILSNYTENHNEG.KKLFDKLK-NHYRTAEDFAEHLDAGDITFLNSILPEEIKYALDEKDEERAEQLNNVYEQLF.
A0A4Y9ABV1_9BACI/1-82               ..MDNTLDYLLESLVNHRE-NDRA.KQMIGKIKHNDFKSEEEFVRNLDEEEMAYLDAVVEKELNYARNAEDDVRAKQLKEVYELLF.
A0A024QF10_9BACI/1-71               ..-----------MSNYMD-NPYC.QTIVGKMEQGHFASEVAFVKQLSEEELTYLNDVLENEINYAKEVQFDNRVKELTEVYEQLF.
A0A077J3F7_9BACI/1-83               ..MDKTLGYLREILSNYTDMHTEG.KHLYKKLIEGNYDSEETFVRNLNRKEVDFLNKILPEEINYALAEQDKLRAYQLNEVYELLI.
A0A0M1NV99_9BACI/1-83               ..MDRTIGYLREILSNYTDQYPEA.QEIYNKIKSGHFHSEEELVNKLSGKEASLLNHILPQEIKHAKEASDSERVTQLSEVYELII.
U5L6L8_9BACI/1-83                   ..MNQSLGYLRELLSNYTDRSHEC.RELYHKITDDLSEEDNAFVSRLTEQEAAFLNSILPPEIQHAKEELDYKRANKLNEIYELL-t
W4PXR0_9BACI/1-83                   ..MDSNLAYLRESLSNHLEDHPIC.QRIYHKLETKQYKDEDEFVNDLEDNEATILNLILQYELDYAKNEQDEERLQQLNGVYERL-l
K6CYJ8_9BACI/5-87                   ..MDQTLGYLRETLSNYTEDHSEG.RNLYKKLKEGAYTSEASFVRDLNQREIHFLNHMLPKEINYAKEEQDEKRAHELNEVFELLF.
A0A6G1X4E3_9BACI/1-83               ..MDQSLSYLHEVLSNYTEEIGAI.RDIDEKITQNEYTSENLFSRDLDEEESRILREILLKEMHHANESGDHERGYQLHEVYELLY.
A0A385NV71_9BACI/1-83               ..MNKPLAYLREILSNYTDRSDTA.EYISKKIEQGHFPTEESFVRSLSDEENNFLNSILPEEIKHANNEQDETRAKQLNEVYELLF.
A0A2N5MHB0_9BACI/11-91              .v-NQSLLFVREIMAGHTE-SKFG.KSIYDKLTNFSHDT-EDFVRSLTGDEMYYLNNVLAEAIDYSNQERDDERSMQLNRVYELL-t
A0A268E269_9BACI/1-82               ..MDFTLDYLKEAISNYDD-SSVC.QRIFSKLSRRDYKSEMEFVQVLDDAEIHFLNRVLPEEIKYAFHNQDFIRGNQLNEVYELLI.
A0A327JG00_9RHIZ/1-81               ..MDTTLGYLRESLSNHLE-HGIG.QNIYRKIVSGRYANEEEFVEHLEEREMEFLNQVLEHEMKYALNEQDHKRTRELNEVYELL-.
A0A4S4C4R6_9BACI/1-82               ..MDFTIGYLIESLSNY-DRSSVG.SRISKKIEKGQFNSEKDFVLALDEEEIQFLNNILPDEIKYAFDEQDFVRGNQLNEVYELLI.
A0A1H0DXK4_9BACI/1-83               ..MDKTLGYLREILSNYNDGHNEG.RQIYHKLSEGNFTSEGDFVRHLNQKEINFLNKILPNEINYAKEEQDEKRAHELNEVFELLY.
A0A4Q0VMQ5_9BACI/1-83               ..MDATLGYLRESLSNYTEKYPSC.QRIYTKLKEGHYQNEGEFVNDLNEAEMAVLDLVLKNEISYAKKEQDQKRAHELSEVYELLF.
A0A371SGT3_9BACI/1-82               ..MDKTLGYLIESISNYGDENKIS.RAILTKLINNQYRSEEALVRDLDEEEIEFLNKILPDEINYAMDEKDFTRVNQLNEVYELL-.
A0A2C1K4H3_9BACI/1-82               ..MDFTLGYLREALSNY-DRSSVC.HRIYQKLEKGSYVSEKDFVLALEDDEVQFLNNILPDEIKYAFDEQDFIRGNQLNEVYEQLI.
A0A327YM86_9BACI/1-84               ..MEKTLAYLREILSNYTERHDKTpLMIYHKLIRNNYRNEEEFVRDLSQKEIACLDRILPDEIKYAMDERDFERVYQLNEVYELLF.
#=GC seq_cons                       ..MDpTLuYLREsLSNYs-ppshs.ppIYcKlppspYpoEtpFV+cLspcEhpaLNplL.cEIpYAppEQDppRsppLNEVYELLh.
//
DBGET integrated database retrieval system