GenomeNet

Database: Pfam
Entry: DAN
LinkDB: DAN
Original site: DAN 
#=GF ID   DAN
#=GF AC   PF03045.17
#=GF DE   DAN domain
#=GF AU   Bateman A;0000-0002-6982-4660
#=GF SE   Pfam-B_1968 (release 6.4)
#=GF GA   21.00 21.00;
#=GF TC   21.00 21.00;
#=GF NC   20.90 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 57096847 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF CL   CL0079
#=GF RN   [1]
#=GF RM   9660951
#=GF RT   The Xenopus dorsalizing factor Gremlin identifies a novel family
#=GF RT   of secreted proteins that antagonize BMP activities. 
#=GF RA   Hsu DR, Economides AN, Wang X, Eimon PM, Harland RM; 
#=GF RL   Mol Cell 1998;1:673-683.
#=GF RN   [2]
#=GF RM   11134349
#=GF RT   Mutation and analysis of Dan, the founding member of the Dan
#=GF RT   family of transforming growth factor beta antagonists. 
#=GF RA   Dionne MS, Skarnes WC, Harland RM; 
#=GF RL   Mol Cell Biol 2001;21:636-643.
#=GF DR   INTERPRO; IPR004133;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This domain contains 9 conserved cysteines and is extracellular.
#=GF CC   Therefore the cysteines may form disulphide bridges.  This
#=GF CC   family of proteins has been termed the DAN family [1] after the
#=GF CC   first member to be reported. This family includes DAN, Cerberus
#=GF CC   and Gremlin. The gremlin protein is an antagonist of bone
#=GF CC   morphogenetic protein signaling.  It is postulated that all
#=GF CC   members of this family antagonise different TGF beta
#=GF CC   Pfam:PF00019 ligands [1]. Recent work shows that the DAN protein
#=GF CC   is not an efficient antagonist of  BMP-2/4 class signals, we
#=GF CC   found that DAN was able to interact with  GDF-5 in a frog embryo
#=GF CC   assay, suggesting that DAN may regulate signaling by the
#=GF CC   GDF-5/6/7 class of BMPs in vivo [2].
#=GF SQ   1420
#=GS A0A3Q2DAN9_CYPVA/71-181     AC A0A3Q2DAN9.1
#=GS H2TK82_TAKRU/18-127         AC H2TK82.3
#=GS A0A3P8S7J2_AMPPE/52-182     AC A0A3P8S7J2.1
#=GS A0A2Y9LQI7_DELLE/24-124     AC A0A2Y9LQI7.1
#=GS A0A3S2TY35_ORYJA/26-142     AC A0A3S2TY35.1
#=GS B7Q6G3_IXOSC/54-164         AC B7Q6G3.1
#=GS B7ZQZ5_XENLA/69-179         AC B7ZQZ5.1
#=GS A0A1S3HHH5_LINUN/19-125     AC A0A1S3HHH5.1
#=GS A0A091SPD9_PELCR/143-251    AC A0A091SPD9.1
#=GS A0A556TKY2_BAGYA/122-233    AC A0A556TKY2.1
#=GS A0A091U376_PHORB/50-160     AC A0A091U376.1
#=GS G1KD58_ANOCA/53-170         AC G1KD58.1
#=GS A0A0N5D677_THECL/68-182     AC A0A0N5D677.1
#=GS A0A2Y9N812_DELLE/187-296    AC A0A2Y9N812.1
#=GS F7HWY3_CALJA/57-157         AC F7HWY3.2
#=GS A0A091LKK8_9GRUI/32-131     AC A0A091LKK8.1
#=GS A0A2U3W7A8_ODORO/132-241    AC A0A2U3W7A8.1
#=GS L5JSM4_PTEAL/50-160         AC L5JSM4.1
#=GS A0A2I4BT62_9TELE/61-171     AC A0A2I4BT62.1
#=GS A0A6G1BFF7_CROCR/79-189     AC A0A6G1BFF7.1
#=GS A0A674DXM2_SALTR/141-260    AC A0A674DXM2.1
#=GS H3DI09_TETNG/52-167         AC H3DI09.1
#=GS A0A0R4IYE7_DANRE/91-201     AC A0A0R4IYE7.1
#=GS A0A3Q3L2L7_9LABR/126-242    AC A0A3Q3L2L7.1
#=GS A0A665UAU1_ECHNA/26-142     AC A0A665UAU1.1
#=GS A0A2J7QXV2_9NEOP/22-127     AC A0A2J7QXV2.1
#=GS A0A2Y9R091_TRIMA/22-128     AC A0A2Y9R091.1
#=GS A0A1S3Q6A8_SALSA/141-260    AC A0A1S3Q6A8.1
#=GS E2BTT5_HARSA/1-92           AC E2BTT5.1
#=GS A0A3N0YJZ3_ANAGA/126-236    AC A0A3N0YJZ3.1
#=GS A0A3Q2W9Q5_HAPBU/20-124     AC A0A3Q2W9Q5.1
#=GS A0A6A4VPZ1_AMPAM/39-166     AC A0A6A4VPZ1.1
#=GS E9FYK9_DAPPU/3-105          AC E9FYK9.1
#=GS A0A226MMR2_CALSU/142-247    AC A0A226MMR2.1
#=GS A0A2K6CB62_MACNE/186-295    AC A0A2K6CB62.1
#=GS A0A226N9Y5_CALSU/32-131     AC A0A226N9Y5.1
#=GS A0A1L8GDG5_XENLA/1-85       AC A0A1L8GDG5.1
#=GS A0A452FYC1_CAPHI/22-133     AC A0A452FYC1.1
#=GS A0A485N2Y8_LYNPA/113-223    AC A0A485N2Y8.1
#=GS A0A212ES77_DANPL/22-125     AC A0A212ES77.1
#=GS A0A287ABW3_PIG/71-181       AC A0A287ABW3.1
#=GS A0A2H2IAN1_CAEJA/271-384    AC A0A2H2IAN1.1
#=GS B3RZY0_TRIAD/54-165         AC B3RZY0.1
#=GS A0A0N4WRT2_HAEPC/5-60       AC A0A0N4WRT2.1
#=GS A0A674DZ17_SALTR/119-238    AC A0A674DZ17.1
#=GS A0A674EFK1_SALTR/52-162     AC A0A674EFK1.1
#=GS A0A2I0UJZ1_LIMLA/71-181     AC A0A2I0UJZ1.1
#=GS A0A671WK08_SPAAU/48-157     AC A0A671WK08.1
#=GS A0A5C6N4A2_9TELE/122-230    AC A0A5C6N4A2.1
#=GS A0A0K0JBZ8_BRUMA/112-240    AC A0A0K0JBZ8.1
#=GS A0A091MMU4_9PASS/49-160     AC A0A091MMU4.1
#=GS A0A091P6A4_APAVI/31-131     AC A0A091P6A4.1
#=GS A0A067QPK9_ZOONE/441-547    AC A0A067QPK9.1
#=GS G3WY53_SARHA/138-245        AC G3WY53.1
#=GS A0A482W2Q0_9CUCU/125-251    AC A0A482W2Q0.1
#=GS A0A0V0UDT8_9BILA/159-280    AC A0A0V0UDT8.1
#=GS G5BYV8_HETGA/75-186         AC G5BYV8.1
#=GS A0A3Q1H1V5_9TELE/57-167     AC A0A3Q1H1V5.1
#=GS F7AY10_CIOIN/20-103         AC F7AY10.2
#=GS A0A0A0AVT2_CHAVO/32-131     AC A0A0A0AVT2.1
#=GS C3XXU5_BRAFL/34-153         AC C3XXU5.1
#=GS A0A3P4PKL1_GULGU/20-119     AC A0A3P4PKL1.1
#=GS A0A1L8FHM0_XENLA/25-123     AC A0A1L8FHM0.1
#=GS A0A091TPR0_PHALP/32-131     AC A0A091TPR0.1
#=GS A0A182HF90_AEDAL/1-87       AC A0A182HF90.1
#=GS W5LSW2_ASTMX/65-189         AC W5LSW2.2
#=GS A0A195B087_9HYME/22-124     AC A0A195B087.1
#=GS A0A4S2JC10_9HYME/96-211     AC A0A4S2JC10.1
#=GS A0A2K5JBB4_COLAP/135-244    AC A0A2K5JBB4.1
#=GS H2LKS0_ORYLA/53-184         AC H2LKS0.2
#=GS A0A2I2UQD1_FELCA/17-124     AC A0A2I2UQD1.1
#=GS A0A1L8H2X4_XENLA/93-200     AC A0A1L8H2X4.1
#=GS A0A4X2KQP1_VOMUR/71-181     AC A0A4X2KQP1.1
#=GS A0A093P6T6_PYGAD/31-131     AC A0A093P6T6.1
#=GS G3QRB6_GORGO/56-156         AC G3QRB6.2
#=GS A0A182XZX3_ANOST/129-273    AC A0A182XZX3.1
#=GS A0A2K5DKG5_AOTNA/135-244    AC A0A2K5DKG5.1
#=GS H0XRI1_OTOGA/67-179         AC H0XRI1.1
#=GS V3ZP56_LOTGI/34-145         AC V3ZP56.1
#=GS A0A091F550_CORBR/71-174     AC A0A091F550.1
#=GS A0A444U7E5_ACIRT/468-578    AC A0A444U7E5.1
#=GS A0A3S3P852_9ACAR/51-154     AC A0A3S3P852.1
#=GS M4B0L1_XIPMA/69-179         AC M4B0L1.1
#=GS W4Z7N0_STRPU/269-370        AC W4Z7N0.1
#=GS R7TLH9_CAPTE/1-112          AC R7TLH9.1
#=GS A0A2K6A0R5_MANLE/135-244    AC A0A2K6A0R5.1
#=GS A0A2U3YMC2_LEPWE/50-160     AC A0A2U3YMC2.1
#=GS A0A194PN16_PAPXU/1-108      AC A0A194PN16.1
#=GS L5JS10_PTEAL/25-125         AC L5JS10.1
#=GS F7DS65_HORSE/135-244        AC F7DS65.1
#=GS A0A0L7LPR3_9NEOP/10-113     AC A0A0L7LPR3.1
#=GS A0A2K6JVD7_RHIBE/50-160     AC A0A2K6JVD7.1
#=GS A0A093IFB0_FULGA/143-251    AC A0A093IFB0.1
#=GS A0A1S3AC13_ERIEU/50-160     AC A0A1S3AC13.1
#=GS A0A3P8XJF4_ESOLU/51-176     AC A0A3P8XJF4.2
#=GS A0A091HYI1_CALAN/49-160     AC A0A091HYI1.1
#=GS A0A673CFC4_9TELE/27-142     AC A0A673CFC4.1
#=GS A0A0C2DBP7_9BILA/1-72       AC A0A0C2DBP7.1
#=GS A0A3P9A1V7_ESOLU/16-124     AC A0A3P9A1V7.2
#=GS A0A2U9CPM7_SCOMX/78-188     AC A0A2U9CPM7.1
#=GS NBL1_HUMAN/23-123           AC P41271.2
#=GS NBL1_HUMAN/23-123           DR PDB; 4X1J B; 30-123;
#=GS NBL1_HUMAN/23-123           DR PDB; 4X1J A; 30-123;
#=GS NBL1_HUMAN/23-123           DR PDB; 4YU8 A; 33-123;
#=GS A0A091LSQ6_CARIC/32-131     AC A0A091LSQ6.1
#=GS A0A5F8H5Z2_MONDO/69-179     AC A0A5F8H5Z2.1
#=GS A0A437DF66_ORYJA/72-171     AC A0A437DF66.1
#=GS F7CG49_MONDO/138-245        AC F7CG49.2
#=GS W5JWG9_ANODA/173-330        AC W5JWG9.1
#=GS M3Z7Z6_MUSPF/71-181         AC M3Z7Z6.1
#=GS A8E7M9_DANRE/118-229        AC A8E7M9.1
#=GS A0A3Q3MJB7_9LABR/83-193     AC A0A3Q3MJB7.1
#=GS H2UE98_TAKRU/29-140         AC H2UE98.2
#=GS A0A3B1IDF9_ASTMX/107-209    AC A0A3B1IDF9.1
#=GS A0A3Q3H138_KRYMA/12-124     AC A0A3Q3H138.1
#=GS A0A060X385_ONCMY/70-180     AC A0A060X385.1
#=GS I3N7W2_ICTTR/14-122         AC I3N7W2.2
#=GS A0A183J4A9_9BILA/22-109     AC A0A183J4A9.1
#=GS G1KC57_ANOCA/61-172         AC G1KC57.2
#=GS L5LLA1_MYODS/78-189         AC L5LLA1.1
#=GS A0A4U5P0D4_STECR/20-97      AC A0A4U5P0D4.1
#=GS A0A2Y9DM89_TRIMA/22-122     AC A0A2Y9DM89.1
#=GS A0A0R4ICD7_DANRE/47-158     AC A0A0R4ICD7.1
#=GS C3XZB3_BRAFL/18-122         AC C3XZB3.1
#=GS E7F073_DANRE/29-137         AC E7F073.1
#=GS A0A091FUZ8_9AVES/140-248    AC A0A091FUZ8.1
#=GS A0A091LH73_CATAU/143-251    AC A0A091LH73.1
#=GS A0A674EEU9_SALTR/51-158     AC A0A674EEU9.1
#=GS A0A663DPZ0_AQUCH/40-139     AC A0A663DPZ0.1
#=GS A0A2K5L2F0_CERAT/50-160     AC A0A2K5L2F0.1
#=GS A0A158NRD9_ATTCE/18-133     AC A0A158NRD9.1
#=GS A0A401Q5T5_SCYTO/58-157     AC A0A401Q5T5.1
#=GS A0A3P8SCY9_AMPPE/66-176     AC A0A3P8SCY9.1
#=GS F7IPU3_CALJA/77-188         AC F7IPU3.1
#=GS A0A091ERK4_CORBR/31-128     AC A0A091ERK4.1
#=GS A0A3P7VJF8_HAEPC/1-94       AC A0A3P7VJF8.1
#=GS A0A1S3S7S2_SALSA/51-176     AC A0A1S3S7S2.1
#=GS A0A4W5MQQ3_9TELE/28-136     AC A0A4W5MQQ3.1
#=GS A0A2K6NH78_RHIRO/50-160     AC A0A2K6NH78.1
#=GS A0A2K6S6X1_SAIBB/135-244    AC A0A2K6S6X1.1
#=GS A0A3P9BZ73_9CICH/20-124     AC A0A3P9BZ73.1
#=GS A0A2R8ZBR1_PANPA/50-160     AC A0A2R8ZBR1.1
#=GS F1PRH2_CANLF/34-134         AC F1PRH2.3
#=GS A0A2K6KK89_RHIBE/135-244    AC A0A2K6KK89.1
#=GS A0A2U9CD30_SCOMX/140-251    AC A0A2U9CD30.1
#=GS A0A2I4AN10_9TELE/52-184     AC A0A2I4AN10.1
#=GS A0A3Q7TV45_VULVU/50-160     AC A0A3Q7TV45.1
#=GS A0A0V1P6G7_9BILA/159-280    AC A0A0V1P6G7.1
#=GS A0A4W6DYH2_LATCA/69-179     AC A0A4W6DYH2.1
#=GS A0A093Q8S2_9PASS/49-160     AC A0A093Q8S2.1
#=GS A0A310SDE3_9HYME/18-132     AC A0A310SDE3.1
#=GS A0A2F0BG53_ESCRO/135-244    AC A0A2F0BG53.1
#=GS A0A4U1ERX5_MONMO/100-178    AC A0A4U1ERX5.1
#=GS A0A444UU80_ACIRT/11-130     AC A0A444UU80.1
#=GS A0A026WU74_OOCBI/9-106      AC A0A026WU74.1
#=GS A0A3Q2G7I1_CYPVA/15-124     AC A0A3Q2G7I1.1
#=GS A0A2Y9LFX4_ENHLU/78-189     AC A0A2Y9LFX4.1
#=GS A0A0D8XR35_DICVI/27-103     AC A0A0D8XR35.1
#=GS A0A4X2LDV6_VOMUR/50-156     AC A0A4X2LDV6.1
#=GS G1RR80_NOMLE/75-188         AC G1RR80.1
#=GS A0A0M3K7B7_ANISI/81-195     AC A0A0M3K7B7.1
#=GS A0A6I8NEC2_ORNAN/24-124     AC A0A6I8NEC2.1
#=GS A0A6H5IJQ5_9HYME/8-120      AC A0A6H5IJQ5.1
#=GS A0A094KY71_PODCR/143-251    AC A0A094KY71.1
#=GS A0A673UJR4_SURSU/104-203    AC A0A673UJR4.1
#=GS A0A087YS06_POEFO/69-179     AC A0A087YS06.1
#=GS A0A2A3E9R4_APICC/124-232    AC A0A2A3E9R4.1
#=GS A0A671E0T7_RHIFE/127-237    AC A0A671E0T7.1
#=GS G1N1H7_MELGA/23-123         AC G1N1H7.2
#=GS U3I1Q8_ANAPP/263-373        AC U3I1Q8.2
#=GS A0A2K5WJN9_MACFA/135-244    AC A0A2K5WJN9.1
#=GS A0A4W4HD89_ELEEL/54-163     AC A0A4W4HD89.1
#=GS NBL1_DANRE/15-126           AC Q6NZ13.1
#=GS A0A0V1MP26_9BILA/153-291    AC A0A0V1MP26.1
#=GS T1JVR8_TETUR/22-115         AC T1JVR8.1
#=GS A0A672U319_STRHB/23-123     AC A0A672U319.1
#=GS A0A6I8SGT6_XENTR/58-157     AC A0A6I8SGT6.1
#=GS E3LPN6_CAERE/240-353        AC E3LPN6.1
#=GS E2A3Q3_CAMFO/21-124         AC E2A3Q3.1
#=GS A0A673CQH6_9TELE/43-151     AC A0A673CQH6.1
#=GS A0A5C6NQD6_9TELE/66-176     AC A0A5C6NQD6.1
#=GS E2ADC3_CAMFO/61-176         AC E2ADC3.1
#=GS A0A3Q1MAY6_BOVIN/366-465    AC A0A3Q1MAY6.1
#=GS A6Q0K7_STRPU/3-117          AC A6Q0K7.1
#=GS A0A0L8HLI6_OCTBM/90-204     AC A0A0L8HLI6.1
#=GS H2SM98_TAKRU/125-241        AC H2SM98.1
#=GS A0A3P8UGB9_CYNSE/29-144     AC A0A3P8UGB9.1
#=GS GREM2_HUMAN/50-160          AC Q9H772.1
#=GS A0A4D9EB53_9SAUR/54-165     AC A0A4D9EB53.1
#=GS A0A3B5QUG9_XIPMA/10-119     AC A0A3B5QUG9.1
#=GS A0A2K5C3I5_AOTNA/50-160     AC A0A2K5C3I5.1
#=GS A0A151N390_ALLMI/54-159     AC A0A151N390.1
#=GS A0A060XZZ1_ONCMY/69-179     AC A0A060XZZ1.1
#=GS H3CKP0_TETNG/125-241        AC H3CKP0.1
#=GS A0A340Y632_LIPVE/77-184     AC A0A340Y632.1
#=GS A0A154NY08_DUFNO/12-115     AC A0A154NY08.1
#=GS A0A3Q2VWK7_HAPBU/127-241    AC A0A3Q2VWK7.1
#=GS A0A182YHP9_ANOST/10-108     AC A0A182YHP9.1
#=GS A0A3P8YTP5_ESOLU/39-149     AC A0A3P8YTP5.2
#=GS A0A194QN72_PAPMA/1-108      AC A0A194QN72.1
#=GS A0A2I2ZEZ2_GORGO/50-160     AC A0A2I2ZEZ2.1
#=GS A0A2I2YQG1_GORGO/76-188     AC A0A2I2YQG1.1
#=GS A0A4W5Q5D9_9TELE/248-367    AC A0A4W5Q5D9.1
#=GS A0A093IVP7_FULGA/32-128     AC A0A093IVP7.1
#=GS F7GY73_CALJA/58-158         AC F7GY73.2
#=GS A0A091SNM5_PELCR/49-160     AC A0A091SNM5.1
#=GS H0VKC4_CAVPO/133-242        AC H0VKC4.2
#=GS A0A4U5VCZ7_COLLU/52-184     AC A0A4U5VCZ7.1
#=GS A0A2K6PM55_RHIRO/76-188     AC A0A2K6PM55.1
#=GS A0A091PDP8_APAVI/143-251    AC A0A091PDP8.1
#=GS A0A3P9B5X7_9CICH/66-176     AC A0A3P9B5X7.1
#=GS W5M1N2_LEPOC/26-137         AC W5M1N2.1
#=GS L5LDE5_MYODS/19-124         AC L5LDE5.1
#=GS A0A653DF41_CALMS/6-111      AC A0A653DF41.1
#=GS A0A3S1B6D3_ELYCH/171-281    AC A0A3S1B6D3.1
#=GS A0A452EMV2_CAPHI/14-124     AC A0A452EMV2.1
#=GS H3C4U3_TETNG/32-132         AC H3C4U3.1
#=GS A0A091JZQ4_EGRGA/143-251    AC A0A091JZQ4.1
#=GS A0A4W4FDK7_ELEEL/48-158     AC A0A4W4FDK7.1
#=GS E2QVG1_CANLF/53-163         AC E2QVG1.2
#=GS A0A340XJV6_LIPVE/22-122     AC A0A340XJV6.1
#=GS H0Z2F5_TAEGU/143-251        AC H0Z2F5.1
#=GS A0A4D9F8E0_9SAUR/1-88       AC A0A4D9F8E0.1
#=GS H3DJ93_TETNG/59-169         AC H3DJ93.1
#=GS G3HCA3_CRIGR/135-244        AC G3HCA3.1
#=GS A0A087QJS5_APTFO/71-181     AC A0A087QJS5.1
#=GS A0A2I3N3V5_PAPAN/58-158     AC A0A2I3N3V5.1
#=GS A0A091S1R3_NESNO/49-160     AC A0A091S1R3.1
#=GS A0A093PXX0_9PASS/142-250    AC A0A093PXX0.1
#=GS A0A498M7V5_LABRO/64-174     AC A0A498M7V5.1
#=GS A0A091NU69_HALAL/49-160     AC A0A091NU69.1
#=GS A0A4U5UB98_COLLU/82-186     AC A0A4U5UB98.1
#=GS A0A341CR14_NEOAA/110-219    AC A0A341CR14.1
#=GS A0A2I3RWS4_PANTR/58-158     AC A0A2I3RWS4.1
#=GS W4YVX7_STRPU/61-176         AC W4YVX7.1
#=GS A0A087VNN2_BALRE/49-160     AC A0A087VNN2.1
#=GS A0A5J5DNT1_9PERO/130-244    AC A0A5J5DNT1.1
#=GS W5N2Q5_LEPOC/57-173         AC W5N2Q5.1
#=GS A0A498LBD8_LABRO/59-169     AC A0A498LBD8.1
#=GS A0A1W4WHP9_AGRPL/33-145     AC A0A1W4WHP9.1
#=GS W5N4F1_LEPOC/73-183         AC W5N4F1.1
#=GS A0A6A5FLA7_PERFL/59-163     AC A0A6A5FLA7.1
#=GS A0A4D9ETL9_9SAUR/42-141     AC A0A4D9ETL9.1
#=GS A0A2Y9DK17_TRIMA/50-160     AC A0A2Y9DK17.1
#=GS A0A2I4B246_9TELE/19-130     AC A0A2I4B246.1
#=GS S9Y9A5_CAMFR/49-92          AC S9Y9A5.1
#=GS A0A3Q3WQV3_MOLML/60-170     AC A0A3Q3WQV3.1
#=GS A0A210R5R2_MIZYE/15-117     AC A0A210R5R2.1
#=GS A0A4W5QJ12_9TELE/227-339    AC A0A4W5QJ12.1
#=GS A0A3Q1CSU0_AMPOC/52-182     AC A0A3Q1CSU0.1
#=GS A0A674CSK5_SALTR/365-484    AC A0A674CSK5.1
#=GS A0A553MRZ6_9TELE/68-178     AC A0A553MRZ6.1
#=GS A0A3Q3WND1_MOLML/53-185     AC A0A3Q3WND1.1
#=GS A0A2K6RTQ9_RHIRO/57-157     AC A0A2K6RTQ9.1
#=GS A0A286XYF5_CAVPO/53-170     AC A0A286XYF5.1
#=GS F6UA84_ORNAN/56-166         AC F6UA84.2
#=GS A0A5N3XS81_MUNRE/15-124     AC A0A5N3XS81.1
#=GS G3P6X1_GASAC/52-167         AC G3P6X1.1
#=GS A0A6I8UN53_DROPS/28-141     AC A0A6I8UN53.1
#=GS A0A443QL31_9ACAR/1-87       AC A0A443QL31.1
#=GS A0A2K6S799_SAIBB/57-157     AC A0A2K6S799.1
#=GS A0A226PQP6_COLVI/1844-1928  AC A0A226PQP6.1
#=GS A0A340XQU2_LIPVE/25-140     AC A0A340XQU2.1
#=GS A0A091VE11_NIPNI/71-179     AC A0A091VE11.1
#=GS A0A2G5TGR8_9PELO/242-355    AC A0A2G5TGR8.1
#=GS A0A287A2H0_PIG/127-237      AC A0A287A2H0.1
#=GS A0A091P2N7_APAVI/71-181     AC A0A091P2N7.1
#=GS A0A091PMF7_HALAL/143-251    AC A0A091PMF7.1
#=GS A0A091LY13_CATAU/49-160     AC A0A091LY13.1
#=GS A0A1U7SDG3_ALLSI/145-252    AC A0A1U7SDG3.1
#=GS M3W3X3_FELCA/69-179         AC M3W3X3.2
#=GS H3B6P7_LATCH/124-233        AC H3B6P7.1
#=GS W5LUB0_ASTMX/48-148         AC W5LUB0.2
#=GS A0A2U3WJV0_ODORO/1-111      AC A0A2U3WJV0.1
#=GS A0A3M6UQP3_9CNID/30-140     AC A0A3M6UQP3.1
#=GS H2UGZ2_TAKRU/69-179         AC H2UGZ2.3
#=GS E5RFZ1_HUMAN/22-122         AC E5RFZ1.1
#=GS A0A091IXB8_EGRGA/71-167     AC A0A091IXB8.1
#=GS A0A669C3C3_ORENI/20-124     AC A0A669C3C3.1
#=GS H2N3A5_PONAB/50-160         AC H2N3A5.1
#=GS A0A2K6WA20_ONCVO/119-240    AC A0A2K6WA20.1
#=GS A0A2K6K068_RHIBE/57-157     AC A0A2K6K068.1
#=GS H2PS54_PONAB/135-215        AC H2PS54.2
#=GS L8Y9F9_TUPCH/135-244        AC L8Y9F9.1
#=GS A0A4U1ELB5_MONMO/239-349    AC A0A4U1ELB5.1
#=GS A0A091GUL7_BUCRH/49-160     AC A0A091GUL7.1
#=GS F7DJA6_MACMU/135-244        AC F7DJA6.1
#=GS A0A673T6T5_SURSU/50-160     AC A0A673T6T5.1
#=GS A0A6A1QFU2_BALPH/36-119     AC A0A6A1QFU2.1
#=GS A0A5C6P2A9_9TELE/69-179     AC A0A5C6P2A9.1
#=GS W5NLG3_LEPOC/47-158         AC W5NLG3.1
#=GS A0A3Q1J119_ANATE/27-142     AC A0A3Q1J119.1
#=GS A0A091QVM1_MERNU/49-160     AC A0A091QVM1.1
#=GS A0A3Q7U6H0_URSAR/71-181     AC A0A3Q7U6H0.1
#=GS A0A016UEQ8_9BILA/111-221    AC A0A016UEQ8.1
#=GS A0A0R3PG09_ANGCS/145-251    AC A0A0R3PG09.1
#=GS K1QSB9_CRAGI/2-87           AC K1QSB9.1
#=GS A0A5E4PRR9_9NEOP/185-302    AC A0A5E4PRR9.1
#=GS A0A4W5RC07_9TELE/16-124     AC A0A4W5RC07.1
#=GS A0A2I0MG52_COLLI/143-251    AC A0A2I0MG52.1
#=GS A0A4X2K141_VOMUR/126-225    AC A0A4X2K141.1
#=GS A0A1Y3ANS8_EURMA/22-127     AC A0A1Y3ANS8.1
#=GS A0A2B4S149_STYPI/202-305    AC A0A2B4S149.1
#=GS A0A3B1JEM7_ASTMX/58-168     AC A0A3B1JEM7.1
#=GS A0A2P4T7B3_BAMTH/49-160     AC A0A2P4T7B3.1
#=GS A0A226ESI8_FOLCA/325-430    AC A0A226ESI8.1
#=GS A0A484CS71_PERFV/69-181     AC A0A484CS71.1
#=GS A0A0C2CWH2_9BILA/27-113     AC A0A0C2CWH2.1
#=GS A0A2T7NZC2_POMCA/57-172     AC A0A2T7NZC2.1
#=GS A0A195EXF7_9HYME/77-191     AC A0A195EXF7.1
#=GS I3KYY6_ORENI/69-179         AC I3KYY6.1
#=GS A0A0V1NMT1_9BILA/19-121     AC A0A0V1NMT1.1
#=GS A0A3Q4GMT2_NEOBR/19-122     AC A0A3Q4GMT2.1
#=GS A0A084VXY8_ANOSI/10-118     AC A0A084VXY8.1
#=GS A0A6A4VMI9_AMPAM/14-110     AC A0A6A4VMI9.1
#=GS A0A093D296_TAUER/32-131     AC A0A093D296.1
#=GS A0A4X2L2Z4_VOMUR/87-199     AC A0A4X2L2Z4.1
#=GS A0A3P9D0H9_9CICH/28-143     AC A0A3P9D0H9.1
#=GS A0A2K5RM82_CEBCA/58-158     AC A0A2K5RM82.1
#=GS C6SUQ1_CIOSA/9-115          AC C6SUQ1.1
#=GS A0A1S3HEG2_LINUN/26-132     AC A0A1S3HEG2.1
#=GS D6X356_TRICA/9-119          AC D6X356.1
#=GS G3UFT9_LOXAF/22-122         AC G3UFT9.1
#=GS A0A3Q3W9I1_MOLML/128-250    AC A0A3Q3W9I1.1
#=GS A0A1L8HP10_XENLA/211-318    AC A0A1L8HP10.1
#=GS G3Q764_GASAC/129-246        AC G3Q764.1
#=GS A0A087WTY6_HUMAN/57-157     AC A0A087WTY6.1
#=GS A3KFI4_HUMAN/23-117         AC A3KFI4.1
#=GS A0A1L8GJK7_XENLA/4-120      AC A0A1L8GJK7.1
#=GS B4K981_DROMO/27-140         AC B4K981.1
#=GS A0A3Q4GWE2_NEOBR/20-124     AC A0A3Q4GWE2.1
#=GS A0A5E4A2T8_MARMO/14-122     AC A0A5E4A2T8.1
#=GS A0A3Q1DC16_AMPOC/66-176     AC A0A3Q1DC16.1
#=GS A0A4X2K6G4_VOMUR/24-123     AC A0A4X2K6G4.1
#=GS A0A3S4RHW9_9ACAR/165-274    AC A0A3S4RHW9.1
#=GS A0A0V0TIS7_9BILA/11-111     AC A0A0V0TIS7.1
#=GS A0A384D167_URSMA/25-140     AC A0A384D167.1
#=GS A0A671U4D2_SPAAU/130-236    AC A0A671U4D2.1
#=GS A0A3N0YYE6_ANAGA/60-170     AC A0A3N0YYE6.1
#=GS A0A0L7K2C7_9NEOP/1-88       AC A0A0L7K2C7.1
#=GS A0A383ZAK0_BALAS/78-184     AC A0A383ZAK0.1
#=GS A0A2K5KQH2_CERAT/135-244    AC A0A2K5KQH2.1
#=GS A0A6A1QCV0_BALPH/59-140     AC A0A6A1QCV0.1
#=GS A0A091RVN8_MERNU/31-108     AC A0A091RVN8.1
#=GS A0A2R9CG90_PANPA/23-123     AC A0A2R9CG90.1
#=GS H3AU53_LATCH/17-131         AC H3AU53.1
#=GS A0A016TQ13_9BILA/25-125     AC A0A016TQ13.1
#=GS T1HWY4_RHOPR/61-174         AC T1HWY4.1
#=GS U3HYK2_ANAPP/71-181         AC U3HYK2.1
#=GS G1R8Q8_NOMLE/58-158         AC G1R8Q8.1
#=GS A0A3Q2DRY8_CYPVA/133-247    AC A0A3Q2DRY8.1
#=GS H2NCY3_PONAB/16-124         AC H2NCY3.1
#=GS A0A091MUY4_9PASS/71-166     AC A0A091MUY4.1
#=GS A0A3P4PKR3_GULGU/71-181     AC A0A3P4PKR3.1
#=GS A0A2K6EM56_PROCO/50-160     AC A0A2K6EM56.1
#=GS A0A3P9AP61_ESOLU/141-260    AC A0A3P9AP61.1
#=GS A0A2U3VPP0_ODORO/22-122     AC A0A2U3VPP0.1
#=GS A0A2I4AXU3_9TELE/127-237    AC A0A2I4AXU3.1
#=GS A0A091SAT7_NESNO/71-169     AC A0A091SAT7.1
#=GS A0A1V4KFI5_PATFA/71-181     AC A0A1V4KFI5.1
#=GS A0A383ZGX9_BALAS/15-124     AC A0A383ZGX9.1
#=GS A0A4W6ESD5_LATCA/20-118     AC A0A4W6ESD5.1
#=GS A0A1S2ZMP6_ERIEU/70-180     AC A0A1S2ZMP6.1
#=GS A0A3Q7SKV5_VULVU/132-241    AC A0A3Q7SKV5.1
#=GS A0A2K6K046_RHIBE/58-158     AC A0A2K6K046.1
#=GS A0A093CYK5_TAUER/49-160     AC A0A093CYK5.1
#=GS F6XPS4_HORSE/50-160         AC F6XPS4.1
#=GS A0A2K5J2N7_COLAP/57-157     AC A0A2K5J2N7.1
#=GS A0A674HD84_TAEGU/40-139     AC A0A674HD84.1
#=GS A0A087V3N8_BALRE/31-130     AC A0A087V3N8.1
#=GS DAND5_XENTR/94-200          AC Q28H35.1
#=GS A0A4W4GTM7_ELEEL/60-187     AC A0A4W4GTM7.1
#=GS A0A6A4XAC3_AMPAM/50-163     AC A0A6A4XAC3.1
#=GS V8NA61_OPHHA/47-153         AC V8NA61.1
#=GS A0A5N5N342_PANHP/64-189     AC A0A5N5N342.1
#=GS A0A0D8Y415_DICVI/152-266    AC A0A0D8Y415.1
#=GS A0A2Y9DT85_TRIMA/1-111      AC A0A2Y9DT85.1
#=GS A0A5F8HB26_MONDO/50-156     AC A0A5F8HB26.1
#=GS A0A2K6A7K6_MANLE/23-123     AC A0A2K6A7K6.1
#=GS A0A4Z2H759_9TELE/66-176     AC A0A4Z2H759.1
#=GS BURS_APIME/11-118           AC A2VB89.1
#=GS G3RT16_GORGO/23-123         AC G3RT16.1
#=GS T1H9U3_RHOPR/1-60           AC T1H9U3.1
#=GS A0A5E4MVH6_9HEMI/24-128     AC A0A5E4MVH6.1
#=GS A0A2K5ZPA8_MANLE/76-188     AC A0A2K5ZPA8.1
#=GS A0A0M9AB08_9HYME/17-132     AC A0A0M9AB08.1
#=GS A0A6G0J4V5_LARCR/152-255    AC A0A6G0J4V5.1
#=GS G1RIB3_NOMLE/25-140         AC G1RIB3.2
#=GS A0A060YNB3_ONCMY/16-124     AC A0A060YNB3.1
#=GS A0A226NDT9_CALSU/75-185     AC A0A226NDT9.1
#=GS G1SCR6_RABIT/84-176         AC G1SCR6.2
#=GS A0A369S0B9_9METZ/54-165     AC A0A369S0B9.1
#=GS A0A423T126_PENVA/33-144     AC A0A423T126.1
#=GS A0A091UXF7_NIPNI/32-131     AC A0A091UXF7.1
#=GS A0A4W5NCD4_9TELE/65-175     AC A0A4W5NCD4.1
#=GS G1QAZ6_MYOLU/61-165         AC G1QAZ6.1
#=GS A0A2P4T5C7_BAMTH/143-250    AC A0A2P4T5C7.1
#=GS A0A4U1EY90_MONMO/187-296    AC A0A4U1EY90.1
#=GS H3AQ07_LATCH/25-124         AC H3AQ07.1
#=GS A0A3L8S0M9_CHLGU/109-185    AC A0A3L8S0M9.1
#=GS A0A2K5CHU4_AOTNA/76-188     AC A0A2K5CHU4.1
#=GS A0A3Q3N1N1_9LABR/52-184     AC A0A3Q3N1N1.1
#=GS A0A3N0XP32_ANAGA/48-158     AC A0A3N0XP32.1
#=GS A0A341CN89_NEOAA/135-244    AC A0A341CN89.1
#=GS M7CA48_CHEMY/49-160         AC M7CA48.1
#=GS A0A1U7SXC7_CARSF/68-181     AC A0A1U7SXC7.1
#=GS A0A093CI18_9AVES/71-181     AC A0A093CI18.1
#=GS Q6T937_DANRE/64-174         AC Q6T937.1
#=GS A0A1S3SNM2_SALSA/70-180     AC A0A1S3SNM2.1
#=GS K7GHD2_PELSI/69-179         AC K7GHD2.1
#=GS L5K2K8_PTEAL/71-181         AC L5K2K8.1
#=GS G1SZ55_RABIT/135-244        AC G1SZ55.1
#=GS A0A093JDW3_EURHL/71-176     AC A0A093JDW3.1
#=GS A0A093GJK1_DRYPU/142-249    AC A0A093GJK1.1
#=GS A0A6Q2ZCK3_ESOLU/19-107     AC A0A6Q2ZCK3.1
#=GS A0A087QKY8_APTFO/31-131     AC A0A087QKY8.1
#=GS G1SSI3_RABIT/178-290        AC G1SSI3.2
#=GS A0A3P8T8T0_AMPPE/20-124     AC A0A3P8T8T0.1
#=GS A0A4W3HDK9_CALMI/48-154     AC A0A4W3HDK9.1
#=GS F1R4W0_DANRE/64-189         AC F1R4W0.2
#=GS A0A482WIX7_LAOST/12-122     AC A0A482WIX7.1
#=GS A0A1U7S2R8_ALLSI/126-233    AC A0A1U7S2R8.1
#=GS A0A091LT92_CARIC/143-251    AC A0A091LT92.1
#=GS A0A2K6AP00_MACNE/50-160     AC A0A2K6AP00.1
#=GS S7NNJ6_MYOBR/109-209        AC S7NNJ6.1
#=GS A0A183IUV9_9BILA/105-223    AC A0A183IUV9.1
#=GS F7BVG5_HORSE/23-123         AC F7BVG5.3
#=GS A0A2R9CDM1_PANPA/58-158     AC A0A2R9CDM1.1
#=GS A0A0B1TTI9_OESDE/1-53       AC A0A0B1TTI9.1
#=GS H3ABK4_LATCH/76-186         AC H3ABK4.1
#=GS A0A6G1AJP0_CROCR/23-122     AC A0A6G1AJP0.1
#=GS A0A383ZJS0_BALAS/22-122     AC A0A383ZJS0.1
#=GS A0A2Y9IMH2_ENHLU/127-237    AC A0A2Y9IMH2.1
#=GS A0A093CJR5_TAUER/71-163     AC A0A093CJR5.1
#=GS A0A672URG6_STRHB/71-181     AC A0A672URG6.1
#=GS A0A484B4D7_DRONA/28-141     AC A0A484B4D7.1
#=GS A0A1S3F381_DIPOR/52-162     AC A0A1S3F381.1
#=GS A0A182Y3E8_ANOST/6-118      AC A0A182Y3E8.1
#=GS A0A091RDK3_9GRUI/143-251    AC A0A091RDK3.1
#=GS A0A4Z2J2F8_9TELE/146-258    AC A0A4Z2J2F8.1
#=GS A0A662YQ50_ACIRT/341-451    AC A0A662YQ50.1
#=GS G3SRD8_LOXAF/75-190         AC G3SRD8.1
#=GS E2C0S4_HARSA/460-574        AC E2C0S4.1
#=GS H0Y0D8_OTOGA/50-160         AC H0Y0D8.1
#=GS A0A401NP66_SCYTO/68-178     AC A0A401NP66.1
#=GS A0A2K6SEX7_SAIBB/16-122     AC A0A2K6SEX7.1
#=GS A0A3N0Y0N2_ANAGA/7-79       AC A0A3N0Y0N2.1
#=GS A0A368H8L7_ANCCA/25-107     AC A0A368H8L7.1
#=GS A0A1A6GWN0_NEOLE/57-167     AC A0A1A6GWN0.1
#=GS G3WQ25_SARHA/74-186         AC G3WQ25.1
#=GS A0A2U9BQ81_SCOMX/127-237    AC A0A2U9BQ81.1
#=GS A0A3P8UBQ7_AMPPE/120-237    AC A0A3P8UBQ7.1
#=GS G5BZL2_HETGA/23-123         AC G5BZL2.1
#=GS GREM1_HUMAN/71-181          AC O60565.1
#=GS GREM1_HUMAN/71-181          DR PDB; 5AEJ B; 72-181;
#=GS GREM1_HUMAN/71-181          DR PDB; 5AEJ A; 72-181;
#=GS GREM1_HUMAN/71-181          DR PDB; 5AEJ D; 72-181;
#=GS GREM1_HUMAN/71-181          DR PDB; 5AEJ C; 72-181;
#=GS A0A2K5F187_AOTNA/52-152     AC A0A2K5F187.1
#=GS A0A6G0U4W6_APHGL/34-143     AC A0A6G0U4W6.1
#=GS A0A1V4JKK1_PATFA/73-184     AC A0A1V4JKK1.1
#=GS A0A4W5L0B9_9TELE/47-156     AC A0A4W5L0B9.1
#=GS A0A091QXC9_9GRUI/71-176     AC A0A091QXC9.1
#=GS A0A1J1ILV4_9DIPT/127-255    AC A0A1J1ILV4.1
#=GS A0A1U7T926_CARSF/25-140     AC A0A1U7T926.1
#=GS A0A2Y9GK44_NEOSC/50-160     AC A0A2Y9GK44.1
#=GS A0A340XMF2_LIPVE/71-181     AC A0A340XMF2.1
#=GS G3S6C5_GORGO/25-140         AC G3S6C5.2
#=GS V9KYQ7_CALMI/48-158         AC V9KYQ7.1
#=GS A0A091PX26_HALAL/32-131     AC A0A091PX26.1
#=GS V8NQX1_OPHHA/127-233        AC V8NQX1.1
#=GS A0A4W6EH45_LATCA/52-184     AC A0A4W6EH45.1
#=GS L9L0J8_TUPCH/126-225        AC L9L0J8.1
#=GS A0A5J5D5S9_9PERO/29-142     AC A0A5J5D5S9.1
#=GS A0A1S3PQL7_SALSA/25-141     AC A0A1S3PQL7.1
#=GS A0A672JGG7_SALFA/52-184     AC A0A672JGG7.1
#=GS B4JHI8_DROGR/28-141         AC B4JHI8.1
#=GS A0A4U5UNF8_COLLU/66-176     AC A0A4U5UNF8.1
#=GS A0A3P7HWG2_ANGCS/27-116     AC A0A3P7HWG2.1
#=GS H2MUB2_ORYLA/52-162         AC H2MUB2.2
#=GS A0A2I3TVF0_PANTR/23-123     AC A0A2I3TVF0.1
#=GS H2NXQ8_PONAB/77-188         AC H2NXQ8.1
#=GS A0A673V167_SURSU/21-122     AC A0A673V167.1
#=GS A0A5E4MAY9_9HEMI/21-129     AC A0A5E4MAY9.1
#=GS A0A368FC32_ANCCA/12-86      AC A0A368FC32.1
#=GS A0A669DVU0_ORENI/28-143     AC A0A669DVU0.1
#=GS A0A0P7X4V3_SCLFO/121-231    AC A0A0P7X4V3.1
#=GS A0A674BIX1_SALTR/25-141     AC A0A674BIX1.1
#=GS C6SUP8_STRPU/20-125         AC C6SUP8.1
#=GS G1KUD8_ANOCA/130-237        AC G1KUD8.1
#=GS A0A151P192_ALLMI/2631-2734  AC A0A151P192.1
#=GS A0A2U3XFV2_LEPWE/71-181     AC A0A2U3XFV2.1
#=GS A0A3Q3E1N9_9LABR/26-128     AC A0A3Q3E1N9.1
#=GS A0A670J911_PODMU/44-143     AC A0A670J911.1
#=GS A0A669E6X8_ORENI/55-187     AC A0A669E6X8.1
#=GS A0A0Q3MLB3_AMAAE/49-160     AC A0A0Q3MLB3.1
#=GS A0A091P798_LEPDC/49-160     AC A0A091P798.1
#=GS A0A3Q0IQE1_DIACI/21-134     AC A0A3Q0IQE1.1
#=GS A0A212F3K0_DANPL/10-114     AC A0A212F3K0.1
#=GS A0A3P8Z5J2_ESOLU/27-141     AC A0A3P8Z5J2.1
#=GS A0A3M0KJG1_HIRRU/272-382    AC A0A3M0KJG1.1
#=GS A0A6G0HNJ4_LARCR/131-263    AC A0A6G0HNJ4.1
#=GS G3WT36_SARHA/71-181         AC G3WT36.1
#=GS A0A2U3WJR0_ODORO/127-237    AC A0A2U3WJR0.1
#=GS A0A3Q2CS50_CYPVA/27-142     AC A0A3Q2CS50.1
#=GS A0A091U6Y7_PHORB/71-181     AC A0A091U6Y7.1
#=GS A0A093FYV4_GAVST/143-251    AC A0A093FYV4.1
#=GS A0A1U8C549_MESAU/50-160     AC A0A1U8C549.1
#=GS A0A556UFD9_BAGYA/183-293    AC A0A556UFD9.1
#=GS A0A452IPC8_9SAUR/23-122     AC A0A452IPC8.1
#=GS A0A5F8ADP5_MACMU/251-350    AC A0A5F8ADP5.1
#=GS A0A1S3PQP6_SALSA/70-180     AC A0A1S3PQP6.1
#=GS A0A0K0CVS4_ANGCA/2-95       AC A0A0K0CVS4.1
#=GS T1FTY2_HELRO/180-334        AC T1FTY2.1
#=GS A0A2K6SAN9_SAIBB/50-160     AC A0A2K6SAN9.1
#=GS B4M141_DROVI/29-142         AC B4M141.1
#=GS A0A091UJG2_NIPNI/49-160     AC A0A091UJG2.1
#=GS A0A6A5ECN7_PERFL/66-176     AC A0A6A5ECN7.1
#=GS A0A4C1UA74_EUMVA/12-89      AC A0A4C1UA74.1
#=GS A0A2R9CDS4_PANPA/57-157     AC A0A2R9CDS4.1
#=GS A0A226PB61_COLVI/23-123     AC A0A226PB61.1
#=GS H9G2X9_CAEEL/221-334        AC H9G2X9.1
#=GS A0A3P8UA88_CYNSE/73-183     AC A0A3P8UA88.1
#=GS A8Y489_CAEBR/241-354        AC A8Y489.2
#=GS A0A1S3IPV6_LINUN/19-125     AC A0A1S3IPV6.1
#=GS K7F1G2_PELSI/50-160         AC K7F1G2.1
#=GS A0A663EN91_AQUCH/54-165     AC A0A663EN91.1
#=GS H2QX07_PANTR/135-244        AC H2QX07.1
#=GS A0A093R8P8_PHACA/143-251    AC A0A093R8P8.1
#=GS A0A226PW05_COLVI/75-185     AC A0A226PW05.1
#=GS A0A093EZL7_TYTAL/71-181     AC A0A093EZL7.1
#=GS G1N1X7_MELGA/142-207        AC G1N1X7.1
#=GS A0A3Q2ZAN7_KRYMA/59-169     AC A0A3Q2ZAN7.1
#=GS A0A3Q2E8N0_CYPVA/52-184     AC A0A3Q2E8N0.1
#=GS G1PZV5_MYOLU/126-236        AC G1PZV5.1
#=GS C6SUP7_CAERE/22-120         AC C6SUP7.1
#=GS A0A0J7L645_LASNI/18-133     AC A0A0J7L645.1
#=GS A0A093BVU0_9AVES/31-131     AC A0A093BVU0.1
#=GS T1JJS2_STRMM/4-114          AC T1JJS2.1
#=GS A0A0V1H445_9BILA/167-286    AC A0A0V1H445.1
#=GS A0A2A2J1S6_9BILA/31-106     AC A0A2A2J1S6.1
#=GS A0A2K6RTP8_RHIRO/23-123     AC A0A2K6RTP8.1
#=GS A0A0V0SDK7_9BILA/158-277    AC A0A0V0SDK7.1
#=GS A0A164WQ02_9CRUS/26-135     AC A0A164WQ02.1
#=GS F7BL17_XENTR/69-179         AC F7BL17.2
#=GS A0A2Y9DTA1_TRIMA/71-181     AC A0A2Y9DTA1.1
#=GS A0A673XPI5_SALTR/25-141     AC A0A673XPI5.1
#=GS A0A665T9J3_ECHNA/20-124     AC A0A665T9J3.1
#=GS A0A341BRT3_NEOAA/22-122     AC A0A341BRT3.1
#=GS V8NNP9_OPHHA/50-160         AC V8NNP9.1
#=GS A0A3P8UX55_CYNSE/51-159     AC A0A3P8UX55.1
#=GS G3VXI3_SARHA/51-168         AC G3VXI3.1
#=GS I3MQY1_ICTTR/22-122         AC I3MQY1.1
#=GS F6YPZ6_HORSE/72-183         AC F6YPZ6.3
#=GS A0A194PU44_PAPXU/165-282    AC A0A194PU44.1
#=GS A0A094LF96_PODCR/51-161     AC A0A094LF96.1
#=GS A0A2K6GQ93_PROCO/58-158     AC A0A2K6GQ93.1
#=GS A0A553RQN4_9TELE/523-633    AC A0A553RQN4.1
#=GS A0A2K5R514_CEBCA/16-122     AC A0A2K5R514.1
#=GS A3KFI5_HUMAN/23-123         AC A3KFI5.1
#=GS F7HBP1_MACMU/50-160         AC F7HBP1.1
#=GS A0A3Q2DK94_CYPVA/22-131     AC A0A3Q2DK94.1
#=GS A0A3Q3F6R8_9LABR/25-140     AC A0A3Q3F6R8.1
#=GS A0A1S2ZMP3_ERIEU/26-140     AC A0A1S2ZMP3.1
#=GS A0A091PZ60_LEPDC/32-131     AC A0A091PZ60.1
#=GS G1PUY0_MYOLU/136-245        AC G1PUY0.1
#=GS A0A3P8TVY4_AMPPE/28-142     AC A0A3P8TVY4.1
#=GS A0A0K0EFE2_STRER/75-193     AC A0A0K0EFE2.1
#=GS G3QGR9_GORGO/135-244        AC G3QGR9.1
#=GS A0A2J7PJC7_9NEOP/2-99       AC A0A2J7PJC7.1
#=GS A0A671FYF0_RHIFE/50-160     AC A0A671FYF0.1
#=GS A0A3Q4N2N0_NEOBR/127-241    AC A0A3Q4N2N0.1
#=GS H2MQY0_ORYLA/70-180         AC H2MQY0.2
#=GS BURS_DROME/28-141           AC Q9VD83.1
#=GS A0A091JJS7_EGRGA/49-160     AC A0A091JJS7.1
#=GS A0A2K6S784_SAIBB/23-123     AC A0A2K6S784.1
#=GS A0A6J3R8W8_TURTR/77-184     AC A0A6J3R8W8.1
#=GS A0A3S2TSN9_CHISP/4-112      AC A0A3S2TSN9.1
#=GS E9FS72_DAPPU/25-163         AC E9FS72.1
#=GS H2L366_ORYLA/20-124         AC H2L366.1
#=GS B3LVH1_DROAN/28-141         AC B3LVH1.1
#=GS A0A665X8E7_ECHNA/135-250    AC A0A665X8E7.1
#=GS A0A3N0YJW4_ANAGA/27-97      AC A0A3N0YJW4.1
#=GS A0A6G0J8V1_LARCR/127-243    AC A0A6G0J8V1.1
#=GS A0A2P4SFX2_BAMTH/32-131     AC A0A2P4SFX2.1
#=GS M3YXI9_MUSPF/22-122         AC M3YXI9.1
#=GS A0A3Q1BQ24_AMPOC/69-179     AC A0A3Q1BQ24.1
#=GS A0A6G0ZBL1_APHCR/22-98      AC A0A6G0ZBL1.1
#=GS A0A3S2LS28_CHISP/298-415    AC A0A3S2LS28.1
#=GS D3ZXD0_RAT/50-160           AC D3ZXD0.1
#=GS A0A6J3QZN1_TURTR/137-247    AC A0A6J3QZN1.1
#=GS A0A0B2VA44_TOXCA/142-256    AC A0A0B2VA44.1
#=GS A0A402EU98_9SAUR/69-179     AC A0A402EU98.1
#=GS B9EM59_SALSA/16-124         AC B9EM59.1
#=GS A0A6A5DZI8_PERFL/52-184     AC A0A6A5DZI8.1
#=GS H0XIK1_OTOGA/25-125         AC H0XIK1.1
#=GS A0A139WDF0_TRICA/126-171    AC A0A139WDF0.1
#=GS A0A3P9PD38_POERE/134-248    AC A0A3P9PD38.1
#=GS A0A3Q7TRH5_VULVU/22-122     AC A0A3Q7TRH5.1
#=GS A0A3Q2VHD5_HAPBU/28-143     AC A0A3Q2VHD5.1
#=GS A0A2I3G4Z7_NOMLE/57-157     AC A0A2I3G4Z7.1
#=GS A0A093F1S6_GAVST/71-176     AC A0A093F1S6.1
#=GS A0A093P123_PYGAD/49-160     AC A0A093P123.1
#=GS G7MHC6_MACMU/58-158         AC G7MHC6.1
#=GS S9WGA9_CAMFR/135-244        AC S9WGA9.1
#=GS A0A482VQ54_9CUCU/9-119      AC A0A482VQ54.1
#=GS A0A2Y9EJK0_PHYMC/78-184     AC A0A2Y9EJK0.1
#=GS A0A4W2DPX5_BOBOX/14-124     AC A0A4W2DPX5.1
#=GS H0UUY9_CAVPO/22-122         AC H0UUY9.2
#=GS A0A091JQS5_EGRGA/32-131     AC A0A091JQS5.1
#=GS A0A6H5IYT9_9HYME/52-162     AC A0A6H5IYT9.1
#=GS GREM1_MOUSE/71-181          AC O70326.1
#=GS A0A087Y6A4_POEFO/128-242    AC A0A087Y6A4.1
#=GS A0A1U7U5S4_CARSF/57-157     AC A0A1U7U5S4.1
#=GS G1L523_AILME/133-242        AC G1L523.1
#=GS A0A093NYS3_PYGAD/143-251    AC A0A093NYS3.1
#=GS A0A6G0IE32_LARCR/149-259    AC A0A6G0IE32.1
#=GS A0A4Z2HYF6_9TELE/53-185     AC A0A4Z2HYF6.1
#=GS A0A087X407_POEFO/15-124     AC A0A087X407.2
#=GS A0A3Q4G2A4_NEOBR/66-176     AC A0A3Q4G2A4.1
#=GS A0A673TTZ0_SURSU/133-241    AC A0A673TTZ0.1
#=GS A0A091WMK5_OPIHO/32-131     AC A0A091WMK5.1
#=GS A0A5J5CQB8_9PERO/62-194     AC A0A5J5CQB8.1
#=GS A0A3M6UCK8_9CNID/21-115     AC A0A3M6UCK8.1
#=GS A0A2K6A7L1_MANLE/57-157     AC A0A2K6A7L1.1
#=GS L8HVJ2_9CETA/30-130         AC L8HVJ2.1
#=GS A0A182XY16_ANOST/24-137     AC A0A182XY16.1
#=GS A0A485P4E5_LYNPA/1-102      AC A0A485P4E5.1
#=GS CER1_CHICK/142-250          AC Q9PWB0.1
#=GS E1BN54_BOVIN/135-244        AC E1BN54.1
#=GS A0A183J3V1_9BILA/53-161     AC A0A183J3V1.1
#=GS H0W710_CAVPO/16-124         AC H0W710.1
#=GS L5LPB7_MYODS/23-123         AC L5LPB7.1
#=GS A0A452RJ18_URSAM/50-160     AC A0A452RJ18.1
#=GS A0A3P9DBF0_9CICH/127-241    AC A0A3P9DBF0.1
#=GS A0A553PQJ7_TIGCA/639-743    AC A0A553PQJ7.1
#=GS A0A5J5CQV1_9PERO/282-392    AC A0A5J5CQV1.1
#=GS A0A4W5N472_9TELE/25-141     AC A0A4W5N472.1
#=GS A0A4W5MQQ1_9TELE/16-124     AC A0A4W5MQQ1.1
#=GS A0A670IM06_PODMU/138-248    AC A0A670IM06.1
#=GS A0A3Q7SCV0_VULVU/83-194     AC A0A3Q7SCV0.1
#=GS A0A4X2L6E6_VOMUR/24-123     AC A0A4X2L6E6.1
#=GS A0A671TJ31_SPAAU/36-140     AC A0A671TJ31.1
#=GS D2A239_TRICA/126-252        AC D2A239.1
#=GS A0A4V3S7F1_9HYME/608-708    AC A0A4V3S7F1.1
#=GS G3UQN1_MELGA/130-191        AC G3UQN1.1
#=GS G7NUT0_MACFA/58-158         AC G7NUT0.1
#=GS G3UC34_LOXAF/52-162         AC G3UC34.1
#=GS A0A4W4HA65_ELEEL/16-124     AC A0A4W4HA65.1
#=GS A0A1V4KP94_PATFA/40-139     AC A0A1V4KP94.1
#=GS M3ZDD6_XIPMA/22-131         AC M3ZDD6.1
#=GS R0JMI9_ANAPL/49-160         AC R0JMI9.1
#=GS A0A093GV84_DRYPU/73-183     AC A0A093GV84.1
#=GS A0A0N4VBS1_ENTVE/70-184     AC A0A0N4VBS1.1
#=GS CER1_XENTR/149-256          AC Q07G34.1
#=GS A0A3Q1G2J7_9TELE/17-124     AC A0A3Q1G2J7.1
#=GS A0A2A4JN46_HELVI/114-231    AC A0A2A4JN46.1
#=GS A0A3B1K2Y5_ASTMX/102-215    AC A0A3B1K2Y5.1
#=GS F6V0D3_MONDO/71-181         AC F6V0D3.1
#=GS F1PIN2_CANLF/18-122         AC F1PIN2.2
#=GS A0A094LDG6_PODCR/71-181     AC A0A094LDG6.1
#=GS G1U4Z7_RABIT/23-123         AC G1U4Z7.3
#=GS A0A212C5H0_CEREH/135-244    AC A0A212C5H0.1
#=GS S4S1R9_PETMA/55-167         AC S4S1R9.1
#=GS A0A099ZFA2_TINGU/143-251    AC A0A099ZFA2.1
#=GS A0A553Q0U7_9TELE/113-223    AC A0A553Q0U7.1
#=GS U3KKZ1_FICAL/49-160         AC U3KKZ1.1
#=GS A0A3Q1HL52_ANATE/20-124     AC A0A3Q1HL52.1
#=GS A0A2G9TGT6_TELCI/1-66       AC A0A2G9TGT6.1
#=GS H2QFI1_PANTR/76-188         AC H2QFI1.1
#=GS W5PJ86_SHEEP/30-130         AC W5PJ86.1
#=GS A0A091FQ88_9AVES/71-171     AC A0A091FQ88.1
#=GS L8IQZ7_9CETA/14-124         AC L8IQZ7.1
#=GS A0A3P8W482_CYNSE/131-246    AC A0A3P8W482.1
#=GS A0A218UTK6_9PASE/143-251    AC A0A218UTK6.1
#=GS J9JXY0_ACYPI/20-128         AC J9JXY0.1
#=GS A0A1S3CW54_DIACI/40-145     AC A0A1S3CW54.1
#=GS A0A3B3H819_ORYLA/20-124     AC A0A3B3H819.1
#=GS A0A5A9NPY3_9TELE/64-189     AC A0A5A9NPY3.1
#=GS A0A452CFL8_BALAS/71-181     AC A0A452CFL8.1
#=GS A0A3P9A9H2_ESOLU/49-159     AC A0A3P9A9H2.1
#=GS A0A553RPV9_9TELE/63-188     AC A0A553RPV9.1
#=GS A0A482XJR6_LAOST/17-129     AC A0A482XJR6.1
#=GS G3UHA0_LOXAF/22-122         AC G3UHA0.1
#=GS A0A093LT95_FULGA/71-175     AC A0A093LT95.1
#=GS A0A3P9DRC6_9CICH/52-184     AC A0A3P9DRC6.1
#=GS A0A3N0XJW8_ANAGA/282-392    AC A0A3N0XJW8.1
#=GS A0A667YFP1_9TELE/20-124     AC A0A667YFP1.1
#=GS H2Q1E8_PANTR/50-160         AC H2Q1E8.1
#=GS A7RWM9_NEMVE/256-360        AC A7RWM9.1
#=GS A0A2K5RME3_CEBCA/23-123     AC A0A2K5RME3.1
#=GS A0A1U7QZ41_MESAU/135-244    AC A0A1U7QZ41.1
#=GS A0A2I2UVF9_FELCA/23-123     AC A0A2I2UVF9.2
#=GS L5K930_PTEAL/135-244        AC L5K930.1
#=GS H3BGP6_LATCH/55-164         AC H3BGP6.1
#=GS A0A3P9Q6X6_POERE/69-179     AC A0A3P9Q6X6.1
#=GS A0A5E4MHL7_9HEMI/16-125     AC A0A5E4MHL7.1
#=GS F7IL92_CALJA/50-160         AC F7IL92.1
#=GS A0A3Q1G346_9TELE/120-237    AC A0A3Q1G346.1
#=GS A0A093QQ12_PHACA/31-125     AC A0A093QQ12.1
#=GS A0A077ZEX6_TRITR/146-255    AC A0A077ZEX6.1
#=GS Q7QF01_ANOGA/24-137         AC Q7QF01.5
#=GS A0A668AZV8_9TELE/127-245    AC A0A668AZV8.1
#=GS A0A2U3XH14_LEPWE/78-189     AC A0A2U3XH14.1
#=GS A0A384CE44_URSMA/109-203    AC A0A384CE44.1
#=GS GPHA2_HUMAN/16-124          AC Q96T91.1
#=GS A0A151MHE7_ALLMI/49-160     AC A0A151MHE7.1
#=GS A0A674HQV8_TAEGU/223-333    AC A0A674HQV8.1
#=GS A0A2K5PN94_CEBCA/50-160     AC A0A2K5PN94.1
#=GS A0A1W4WTK5_AGRPL/19-131     AC A0A1W4WTK5.1
#=GS A0A091KIJ6_9GRUI/49-160     AC A0A091KIJ6.1
#=GS A0A151IK56_9HYME/22-124     AC A0A151IK56.1
#=GS A0A2Y9IFN3_NEOSC/78-189     AC A0A2Y9IFN3.1
#=GS A0A2K6DHT4_MACNE/76-188     AC A0A2K6DHT4.1
#=GS A0A6J3QXQ4_TURTR/71-181     AC A0A6J3QXQ4.1
#=GS A0A452GGM0_9SAUR/71-181     AC A0A452GGM0.1
#=GS A0A067R3X7_ZOONE/23-122     AC A0A067R3X7.1
#=GS A0A091JQR3_COLST/71-178     AC A0A091JQR3.1
#=GS A0A433T787_ELYCH/9-117      AC A0A433T787.1
#=GS A0A556V2Y0_BAGYA/537-662    AC A0A556V2Y0.1
#=GS A0A1U7TFD4_CARSF/1-111      AC A0A1U7TFD4.1
#=GS A0A2K5HLH9_COLAP/76-188     AC A0A2K5HLH9.1
#=GS A0A182GP82_AEDAL/21-139     AC A0A182GP82.1
#=GS R4GBJ5_ANOCA/128-241        AC R4GBJ5.1
#=GS A0A1S3NXG6_SALSA/25-141     AC A0A1S3NXG6.1
#=GS A0A341AGN2_NEOAA/71-181     AC A0A341AGN2.1
#=GS A0A2Y9LFM7_DELLE/61-160     AC A0A2Y9LFM7.1
#=GS G3ID48_CRIGR/4-114          AC G3ID48.1
#=GS H2N8S8_PONAB/23-123         AC H2N8S8.2
#=GS A0A3S3P7J6_9ACAR/145-277    AC A0A3S3P7J6.1
#=GS A0A4W2EXU2_BOBOX/23-123     AC A0A4W2EXU2.1
#=GS A0A3M6UVW1_9CNID/470-573    AC A0A3M6UVW1.1
#=GS A0A2K6G4P9_PROCO/135-244    AC A0A2K6G4P9.1
#=GS G1KRN7_ANOCA/68-178         AC G1KRN7.1
#=GS A0A091DE82_FUKDA/135-244    AC A0A091DE82.1
#=GS A0A670IBF9_PODMU/61-172     AC A0A670IBF9.1
#=GS A0A1I7VDG1_LOALO/64-197     AC A0A1I7VDG1.1
#=GS A0A091CPP4_FUKDA/11-110     AC A0A091CPP4.1
#=GS A0A093H1T0_DRYPU/49-160     AC A0A093H1T0.1
#=GS A0A2Y9FKN4_PHYMC/71-181     AC A0A2Y9FKN4.1
#=GS A0A3Q7S5C8_VULVU/71-181     AC A0A3Q7S5C8.1
#=GS A0A060YKU0_ONCMY/68-178     AC A0A060YKU0.1
#=GS A0A553QVL2_9TELE/28-137     AC A0A553QVL2.1
#=GS A0A2Y9DG94_TRIMA/135-244    AC A0A2Y9DG94.1
#=GS A0A1S3F2C3_DIPOR/25-140     AC A0A1S3F2C3.1
#=GS A0A5N5PDZ6_PANHP/30-137     AC A0A5N5PDZ6.1
#=GS A0A444TNV9_ARMVU/41-157     AC A0A444TNV9.1
#=GS A0A093BY60_9AVES/49-160     AC A0A093BY60.1
#=GS A0A2K6GYW7_PROCO/20-124     AC A0A2K6GYW7.1
#=GS A0A665VKK0_ECHNA/64-174     AC A0A665VKK0.1
#=GS A0A093EYH4_GAVST/31-131     AC A0A093EYH4.1
#=GS B5X1L3_SALSA/49-159         AC B5X1L3.1
#=GS A0A556TXP9_BAGYA/30-137     AC A0A556TXP9.1
#=GS A0A1S3SB70_SALSA/68-178     AC A0A1S3SB70.1
#=GS A0A340XMC8_LIPVE/1-111      AC A0A340XMC8.1
#=GS A0A094L9E2_PODCR/31-97      AC A0A094L9E2.1
#=GS A0A667YB09_9TELE/69-179     AC A0A667YB09.1
#=GS A0A4X2K1M4_VOMUR/138-244    AC A0A4X2K1M4.1
#=GS A0A6I8NJR4_ORNAN/17-131     AC A0A6I8NJR4.1
#=GS H3FXB1_PRIPA/168-271        AC H3FXB1.2
#=GS F4WSI7_ACREC/55-170         AC F4WSI7.1
#=GS NBL1_RAT/22-122             AC Q06880.1
#=GS A0A3Q1C1E5_AMPOC/28-142     AC A0A3Q1C1E5.1
#=GS A0A3Q3BSK8_KRYMA/60-170     AC A0A3Q3BSK8.1
#=GS A0A286XYA0_CAVPO/71-181     AC A0A286XYA0.1
#=GS A0A4U0PJS3_9SPHI/11-111     AC A0A4U0PJS3.1
#=GS F7HU74_CALJA/135-244        AC F7HU74.1
#=GS G5AP57_HETGA/92-201         AC G5AP57.1
#=GS A0A3Q3N6R5_9TELE/20-124     AC A0A3Q3N6R5.1
#=GS A0A0P7UZT4_SCLFO/120-230    AC A0A0P7UZT4.1
#=GS A0A6G1AXL3_CROCR/137-242    AC A0A6G1AXL3.1
#=GS GREM1_MACMU/71-181          AC Q8WNY1.1
#=GS A0A060X370_ONCMY/51-176     AC A0A060X370.1
#=GS A0A2I3MT34_PAPAN/76-188     AC A0A2I3MT34.1
#=GS A0A653CYH6_CALMS/27-136     AC A0A653CYH6.1
#=GS Q5TQL9_ANOGA/1-129          AC Q5TQL9.3
#=GS A0A673UA39_SURSU/77-189     AC A0A673UA39.1
#=GS A0A226EM91_FOLCA/25-139     AC A0A226EM91.1
#=GS A0A2I4BIG5_9TELE/69-179     AC A0A2I4BIG5.1
#=GS Q21013_CAEEL/21-119         AC Q21013.2
#=GS A0A3B0K4N7_DROGU/28-141     AC A0A3B0K4N7.1
#=GS A0A026X0H1_OOCBI/19-134     AC A0A026X0H1.1
#=GS A0A315WUH2_GAMAF/145-266    AC A0A315WUH2.1
#=GS A0A1S3M852_SALSA/69-179     AC A0A1S3M852.1
#=GS A0A0L7KR94_9NEOP/110-224    AC A0A0L7KR94.1
#=GS T1JM76_STRMM/26-138         AC T1JM76.1
#=GS B4NIZ9_DROWI/28-141         AC B4NIZ9.1
#=GS A0A2Y9LW96_DELLE/77-184     AC A0A2Y9LW96.1
#=GS A0A151P194_ALLMI/2614-2717  AC A0A151P194.1
#=GS A0A671X635_SPAAU/69-179     AC A0A671X635.1
#=GS A0A2K5PIY9_CEBCA/81-192     AC A0A2K5PIY9.1
#=GS A0A3Q1KB56_ANATE/65-175     AC A0A3Q1KB56.1
#=GS A0A0L7RCI6_9HYME/18-132     AC A0A0L7RCI6.1
#=GS A0A2K5F124_AOTNA/58-158     AC A0A2K5F124.1
#=GS A0A1S3N661_SALSA/49-159     AC A0A1S3N661.1
#=GS A0A3M6UWW7_9CNID/65-172     AC A0A3M6UWW7.1
#=GS A0A482V9E3_9CUCU/16-128     AC A0A482V9E3.1
#=GS A0A2K5WIY3_MACFA/57-157     AC A0A2K5WIY3.1
#=GS W5LU02_ASTMX/61-172         AC W5LU02.2
#=GS A0A0N4T0M4_BRUPA/63-194     AC A0A0N4T0M4.1
#=GS A0A060WN89_ONCMY/70-180     AC A0A060WN89.1
#=GS A0A5N4E9L4_CAMDR/135-244    AC A0A5N4E9L4.1
#=GS NBL1_MOUSE/22-122           AC Q61477.2
#=GS A0A3M0L1B8_HIRRU/143-251    AC A0A3M0L1B8.1
#=GS A0A337SRV2_FELCA/132-241    AC A0A337SRV2.2
#=GS F7BL67_HORSE/14-124         AC F7BL67.2
#=GS A0A1L8FPE6_XENLA/25-123     AC A0A1L8FPE6.1
#=GS A0A2A3EIY8_APICC/18-132     AC A0A2A3EIY8.1
#=GS S7NSC2_MYOBR/73-183         AC S7NSC2.1
#=GS A0A096NEP8_PAPAN/57-157     AC A0A096NEP8.2
#=GS A0A665VC11_ECHNA/47-163     AC A0A665VC11.1
#=GS A0A096MLY5_PAPAN/50-160     AC A0A096MLY5.1
#=GS A0A0D9SEG2_CHLSB/71-181     AC A0A0D9SEG2.1
#=GS A0A6A4W967_AMPAM/20-127     AC A0A6A4W967.1
#=GS A0A1V4KP70_PATFA/95-194     AC A0A1V4KP70.1
#=GS A0A2Y9FIJ7_PHYMC/1-111      AC A0A2Y9FIJ7.1
#=GS A0A2Y9KAT8_ENHLU/22-122     AC A0A2Y9KAT8.1
#=GS A0A2Y9P9X1_DELLE/71-181     AC A0A2Y9P9X1.1
#=GS A0A0N4Y423_NIPBR/25-126     AC A0A0N4Y423.1
#=GS A0A091W664_OPIHO/143-251    AC A0A091W664.1
#=GS A0A0B2VNB0_TOXCA/59-155     AC A0A0B2VNB0.1
#=GS A0A084VLM2_ANOSI/25-138     AC A0A084VLM2.1
#=GS GREM1_CHICK/71-181          AC O73755.1
#=GS A0A091ILT7_CALAN/32-131     AC A0A091ILT7.1
#=GS A0A5N5L218_PANHP/88-183     AC A0A5N5L218.1
#=GS K7G4T2_PELSI/44-143         AC K7G4T2.1
#=GS A0A218VAQ8_9PASE/49-160     AC A0A218VAQ8.1
#=GS A0A4W6FTP9_LATCA/63-173     AC A0A4W6FTP9.1
#=GS A0A3Q2ZSR5_KRYMA/52-184     AC A0A3Q2ZSR5.1
#=GS A0A093QU10_PHACA/49-160     AC A0A093QU10.1
#=GS K7FXV1_PELSI/146-253        AC K7FXV1.1
#=GS D2A4B8_TRICA/15-127         AC D2A4B8.1
#=GS A0A210Q0Y3_MIZYE/86-198     AC A0A210Q0Y3.1
#=GS D2H9I0_AILME/50-160         AC D2H9I0.1
#=GS A0A2K5HJJ1_COLAP/50-160     AC A0A2K5HJJ1.1
#=GS A0A4W5NI81_9TELE/69-179     AC A0A4W5NI81.1
#=GS A0A099ZCW1_TINGU/49-160     AC A0A099ZCW1.1
#=GS A0A091FQB8_9AVES/31-130     AC A0A091FQB8.1
#=GS A0A0G2JSZ3_RAT/22-122       AC A0A0G2JSZ3.1
#=GS A0A4U5LWY2_STECR/157-270    AC A0A4U5LWY2.1
#=GS A0A3P9NB91_POERE/12-119     AC A0A3P9NB91.1
#=GS A0A2Y9HHY0_NEOSC/71-181     AC A0A2Y9HHY0.1
#=GS A0A5C6PR01_9TELE/29-140     AC A0A5C6PR01.1
#=GS A0APK7_DROSI/28-141         AC A0APK7.1
#=GS A0A3Q1HZ58_ANATE/52-184     AC A0A3Q1HZ58.1
#=GS A0A1U7R7H3_MESAU/57-157     AC A0A1U7R7H3.1
#=GS A0A1U7T871_CARSF/134-243    AC A0A1U7T871.1
#=GS A0A671TQN1_SPAAU/27-142     AC A0A671TQN1.1
#=GS A0A3S2LZM6_ORYJA/69-179     AC A0A3S2LZM6.1
#=GS L9KRJ9_TUPCH/19-122         AC L9KRJ9.1
#=GS A0A4W5MKK5_9TELE/168-286    AC A0A4W5MKK5.1
#=GS Q4H3R0_CIOIN/115-236        AC Q4H3R0.1
#=GS G3N7W2_GASAC/22-125         AC G3N7W2.1
#=GS A0A3B5QBK5_XIPMA/49-159     AC A0A3B5QBK5.1
#=GS A0A0B1SYL7_OESDE/3-100      AC A0A0B1SYL7.1
#=GS A0A5E4D040_MARMO/50-160     AC A0A5E4D040.1
#=GS A0A673XFS2_SALTR/13-121     AC A0A673XFS2.1
#=GS A0A182GQ02_AEDAL/7-117      AC A0A182GQ02.1
#=GS A0A3Q3LCD1_9TELE/65-175     AC A0A3Q3LCD1.1
#=GS A0A5C6MWM3_9TELE/112-228    AC A0A5C6MWM3.1
#=GS F1MNJ9_BOVIN/22-122         AC F1MNJ9.2
#=GS A0A1U7SGP8_ALLSI/23-123     AC A0A1U7SGP8.1
#=GS A0A3B5RDD6_XIPMA/27-144     AC A0A3B5RDD6.1
#=GS A0A1B8Y360_XENTR/23-122     AC A0A1B8Y360.1
#=GS A0A2K5F1A2_AOTNA/57-157     AC A0A2K5F1A2.1
#=GS A0A091M0A4_CARIC/71-181     AC A0A091M0A4.1
#=GS A0A0N1PGZ4_PAPMA/188-305    AC A0A0N1PGZ4.1
#=GS A0A1A6GG93_NEOLE/22-122     AC A0A1A6GG93.1
#=GS A0A093R250_PHACA/71-175     AC A0A093R250.1
#=GS A0A5A9NK17_9TELE/64-174     AC A0A5A9NK17.1
#=GS A0A6A4VYL0_AMPAM/6-115      AC A0A6A4VYL0.1
#=GS A0A1U7UTW3_CARSF/50-160     AC A0A1U7UTW3.1
#=GS A0A671FMZ3_RHIFE/23-123     AC A0A671FMZ3.1
#=GS A0A3Q3NNA2_9TELE/34-137     AC A0A3Q3NNA2.1
#=GS A0A0A0B1Q7_CHAVO/49-160     AC A0A0A0B1Q7.1
#=GS A0A1V9XEQ5_9ACAR/57-165     AC A0A1V9XEQ5.1
#=GS A0A2R9AS31_PANPA/16-124     AC A0A2R9AS31.1
#=GS A0A4W5QEY3_9TELE/95-220     AC A0A4W5QEY3.1
#=GS A0A5N5ML95_PANHP/143-253    AC A0A5N5ML95.1
#=GS A0A3Q1BTP4_AMPOC/120-237    AC A0A3Q1BTP4.1
#=GS A0A3P9BT67_9CICH/24-134     AC A0A3P9BT67.1
#=GS A0A3B3HM19_ORYLA/29-142     AC A0A3B3HM19.1
#=GS A0A2U9CUC2_SCOMX/69-179     AC A0A2U9CUC2.1
#=GS M4ASC6_XIPMA/127-241        AC M4ASC6.2
#=GS A0A5F7Z6Z3_MACMU/3-115      AC A0A5F7Z6Z3.1
#=GS CER1_HUMAN/135-244          AC O95813.1
#=GS A0A3Q4HYR1_NEOBR/28-143     AC A0A3Q4HYR1.1
#=GS T0MH60_CAMFR/15-124         AC T0MH60.1
#=GS F6VFY0_HORSE/25-140         AC F6VFY0.2
#=GS A0A1Y1MKW7_PHOPY/120-245    AC A0A1Y1MKW7.1
#=GS A0A673CAG2_9TELE/17-124     AC A0A673CAG2.1
#=GS A0A452GIL7_9SAUR/49-160     AC A0A452GIL7.1
#=GS A0A482WTG1_LAOST/25-141     AC A0A482WTG1.1
#=GS A0A195FC54_9HYME/22-124     AC A0A195FC54.1
#=GS A0A3Q3W2V0_MOLML/28-137     AC A0A3Q3W2V0.1
#=GS A0A2K6REV4_RHIRO/135-244    AC A0A2K6REV4.1
#=GS A0A384DSH8_URSMA/78-190     AC A0A384DSH8.1
#=GS A0A091TPE8_PHALP/71-181     AC A0A091TPE8.1
#=GS A0A151WRJ9_9HYME/22-124     AC A0A151WRJ9.1
#=GS W5J3I6_ANODA/6-118          AC W5J3I6.1
#=GS A0A3Q2VGM0_HAPBU/66-176     AC A0A3Q2VGM0.1
#=GS A0A3Q4HA24_NEOBR/52-184     AC A0A3Q4HA24.1
#=GS A0A4W4GT45_ELEEL/75-179     AC A0A4W4GT45.1
#=GS A0A1S3FHY2_DIPOR/136-244    AC A0A1S3FHY2.1
#=GS A0A2U3WJQ3_ODORO/25-140     AC A0A2U3WJQ3.1
#=GS A0A2G8KYL4_STIJA/120-230    AC A0A2G8KYL4.1
#=GS A0A668AG77_9TELE/25-138     AC A0A668AG77.1
#=GS A0A3P8YB54_ESOLU/17-124     AC A0A3P8YB54.2
#=GS A0A4W5LFY3_9TELE/49-159     AC A0A4W5LFY3.1
#=GS A0A286ZPH0_PIG/135-244      AC A0A286ZPH0.1
#=GS Q7YX42_CAEEL/221-334        AC Q7YX42.2
#=GS A0A0D9R9Z1_CHLSB/135-244    AC A0A0D9R9Z1.1
#=GS A0A3Q2VPG8_HAPBU/52-184     AC A0A3Q2VPG8.1
#=GS A0A0N5CPP4_THECL/45-124     AC A0A0N5CPP4.1
#=GS A0A5N5N541_PANHP/113-223    AC A0A5N5N541.1
#=GS A0A485NCG2_LYNPA/35-135     AC A0A485NCG2.1
#=GS A0A2I0MP83_COLLI/71-173     AC A0A2I0MP83.1
#=GS A0A401S638_CHIPU/138-248    AC A0A401S638.1
#=GS A0A087QI10_APTFO/49-160     AC A0A087QI10.1
#=GS A0A369S6W4_9METZ/8-109      AC A0A369S6W4.1
#=GS A0A2K6S795_SAIBB/58-158     AC A0A2K6S795.1
#=GS A0A1U7R7D9_ALLSI/71-181     AC A0A1U7R7D9.1
#=GS A0A0P6BIF0_9CRUS/17-130     AC A0A0P6BIF0.1
#=GS A0A498LLK2_LABRO/480-605    AC A0A498LLK2.1
#=GS A0A452E4N7_CAPHI/71-181     AC A0A452E4N7.1
#=GS A0A673X6K6_SALTR/16-124     AC A0A673X6K6.1
#=GS J9L6M9_ACYPI/35-144         AC J9L6M9.2
#=GS A0A2K6ECN1_MACNE/58-158     AC A0A2K6ECN1.1
#=GS B4G615_DROPE/28-141         AC B4G615.1
#=GS A0A151I1Z7_9HYME/18-133     AC A0A151I1Z7.1
#=GS A0A0P6CFK1_9CRUS/62-201     AC A0A0P6CFK1.1
#=GS A0A2K6GQA6_PROCO/56-156     AC A0A2K6GQA6.1
#=GS A0A2Y9SRX7_PHYMC/22-122     AC A0A2Y9SRX7.1
#=GS A0A341BRW3_NEOAA/60-160     AC A0A341BRW3.1
#=GS A0A091DJC3_FUKDA/50-160     AC A0A091DJC3.1
#=GS A0A3P9Q9F2_POERE/28-145     AC A0A3P9Q9F2.1
#=GS BURS_BOMMO/25-130           AC Q566B1.1
#=GS A0A2T7NXA4_POMCA/30-138     AC A0A2T7NXA4.1
#=GS H2LF68_ORYLA/167-281        AC H2LF68.2
#=GS A0A3Q3BKL2_HAPBU/18-121     AC A0A3Q3BKL2.1
#=GS A0A2P4SIE9_BAMTH/57-167     AC A0A2P4SIE9.1
#=GS S9XFJ8_CAMFR/145-255        AC S9XFJ8.1
#=GS G3HU31_CRIGR/22-122         AC G3HU31.1
#=GS A3KFI3_HUMAN/23-116         AC A3KFI3.1
#=GS A0A2U3ZXB3_ODORO/50-160     AC A0A2U3ZXB3.1
#=GS A0A2U3VA57_TURTR/187-296    AC A0A2U3VA57.1
#=GS A0A0Q3X9S8_AMAAE/23-123     AC A0A0Q3X9S8.1
#=GS A0A2K5XLC3_MANLE/50-160     AC A0A2K5XLC3.1
#=GS A0A484DFX6_PERFV/92-195     AC A0A484DFX6.1
#=GS A0A2U4A0J4_TURTR/60-160     AC A0A2U4A0J4.1
#=GS A0A2U3VUF2_ODORO/78-189     AC A0A2U3VUF2.1
#=GS A0A1U8CE76_MESAU/96-195     AC A0A1U8CE76.1
#=GS S4RPM8_PETMA/56-145         AC S4RPM8.1
#=GS W4YWX0_STRPU/77-188         AC W4YWX0.1
#=GS A0A0V1D794_TRIBR/153-279    AC A0A0V1D794.1
#=GS A0A091H4B4_BUCRH/143-251    AC A0A091H4B4.1
#=GS M7BJE0_CHEMY/89-181         AC M7BJE0.1
#=GS A0A2K6RTP7_RHIRO/58-158     AC A0A2K6RTP7.1
#=GS L8IU82_9CETA/71-181         AC L8IU82.1
#=GS A0A402FA95_9SAUR/108-218    AC A0A402FA95.1
#=GS A0A674G9W0_TAEGU/71-181     AC A0A674G9W0.1
#=GS NBL1_CHICK/22-122           AC Q90YC9.2
#=GS A0A1U7S9Z1_ALLSI/49-160     AC A0A1U7S9Z1.1
#=GS A0A3S0ZL52_ELYCH/73-179     AC A0A3S0ZL52.1
#=GS A0A4W6FU41_LATCA/130-242    AC A0A4W6FU41.1
#=GS A0A1A6HPJ9_NEOLE/135-244    AC A0A1A6HPJ9.1
#=GS A0A3Q3B8H5_KRYMA/127-241    AC A0A3Q3B8H5.1
#=GS A0A672GDD8_SALFA/126-242    AC A0A672GDD8.1
#=GS A0A4U5U2G8_COLLU/27-142     AC A0A4U5U2G8.1
#=GS R0L8F5_ANAPL/143-251        AC R0L8F5.1
#=GS GREM1_RAT/71-181            AC O35793.1
#=GS A0A5N3X537_MUNRE/135-244    AC A0A5N3X537.1
#=GS E2R030_CANLF/117-227        AC E2R030.2
#=GS A0A1S3EZU8_DIPOR/71-181     AC A0A1S3EZU8.1
#=GS A0A3P8RN98_AMPPE/59-169     AC A0A3P8RN98.1
#=GS A0A2Y9IRC8_ENHLU/48-163     AC A0A2Y9IRC8.1
#=GS A0A2R9BLX9_PANPA/135-244    AC A0A2R9BLX9.1
#=GS A0A3N0YHD0_ANAGA/63-187     AC A0A3N0YHD0.1
#=GS A0A1U7TJG9_CARSF/71-181     AC A0A1U7TJG9.1
#=GS A0A0V1LLZ5_9BILA/151-276    AC A0A0V1LLZ5.1
#=GS L5K5U0_PTEAL/72-184         AC L5K5U0.1
#=GS A0A4Z2JD62_9TELE/59-169     AC A0A4Z2JD62.1
#=GS A0A1U7QXB4_MESAU/22-122     AC A0A1U7QXB4.1
#=GS A0A0D9R2G4_CHLSB/75-188     AC A0A0D9R2G4.1
#=GS A0A093QI74_9PASS/31-130     AC A0A093QI74.1
#=GS A0A401RX13_CHIPU/103-213    AC A0A401RX13.1
#=GS A0A4W2CZM4_BOBOX/135-244    AC A0A4W2CZM4.1
#=GS A0A663EM05_AQUCH/50-161     AC A0A663EM05.1
#=GS A0A3L8SPH3_CHLGU/143-251    AC A0A3L8SPH3.1
#=GS E0VXD8_PEDHC/25-127         AC E0VXD8.1
#=GS A0A3P7DZ72_WUCBA/54-185     AC A0A3P7DZ72.1
#=GS A0A1S3GNT0_DIPOR/69-184     AC A0A1S3GNT0.1
#=GS A0A667ZME1_9TELE/53-184     AC A0A667ZME1.1
#=GS A0A067QSH1_ZOONE/20-127     AC A0A067QSH1.1
#=GS A0A0P7TKK2_SCLFO/52-162     AC A0A0P7TKK2.1
#=GS A0A286XUV4_CAVPO/50-160     AC A0A286XUV4.1
#=GS E5SJB3_TRISP/158-276        AC E5SJB3.1
#=GS V3ZY72_LOTGI/1-111          AC V3ZY72.1
#=GS A0A2Y9T013_PHYMC/22-119     AC A0A2Y9T013.1
#=GS A0A3P9NB88_POERE/21-131     AC A0A3P9NB88.1
#=GS A0A315V4E3_GAMAF/261-377    AC A0A315V4E3.1
#=GS A0A1J1ITX4_9DIPT/152-246    AC A0A1J1ITX4.1
#=GS A0A1S3ABL9_ERIEU/65-177     AC A0A1S3ABL9.1
#=GS G1LEV3_AILME/125-235        AC G1LEV3.1
#=GS A0A3Q3FMW3_KRYMA/30-142     AC A0A3Q3FMW3.1
#=GS A0A0V0RI42_9BILA/18-108     AC A0A0V0RI42.1
#=GS A0A093FHR5_TYTAL/143-251    AC A0A093FHR5.1
#=GS A0A218V7T4_9PASE/138-248    AC A0A218V7T4.1
#=GS A0A0N0U3I1_9HYME/12-118     AC A0A0N0U3I1.1
#=GS A0A2Y9E9K2_TRIMA/74-190     AC A0A2Y9E9K2.1
#=GS A0A340XJ47_LIPVE/60-160     AC A0A340XJ47.1
#=GS A0A482WCD7_9CUCU/2-96       AC A0A482WCD7.1
#=GS A0A212DGZ5_CEREH/15-124     AC A0A212DGZ5.1
#=GS A0A4X2KBC7_VOMUR/50-160     AC A0A4X2KBC7.1
#=GS A0A2Y9KJL3_ENHLU/131-240    AC A0A2Y9KJL3.1
#=GS A0A662YZ58_ACIRT/3-114      AC A0A662YZ58.1
#=GS A0A1D2NDK3_ORCCI/1-89       AC A0A1D2NDK3.1
#=GS A0A384C0X1_URSMA/133-242    AC A0A384C0X1.1
#=GS A0A226NYR6_COLVI/49-160     AC A0A226NYR6.1
#=GS H9J6U1_BOMMO/113-229        AC H9J6U1.1
#=GS A0A154P1H0_DUFNO/335-448    AC A0A154P1H0.1
#=GS A0A673CW03_9TELE/130-245    AC A0A673CW03.1
#=GS A0A2K6TSH3_SAIBB/75-188     AC A0A2K6TSH3.1
#=GS T1EKQ0_HELRO/1-105          AC T1EKQ0.1
#=GS A0A0D9SDE1_CHLSB/50-160     AC A0A0D9SDE1.1
#=GS E2REL8_CANLF/132-241        AC E2REL8.2
#=GS A0A5N4E3P2_CAMDR/71-181     AC A0A5N4E3P2.1
#=GS A0A212F128_DANPL/193-310    AC A0A212F128.1
#=GS A0A663F2Z3_AQUCH/143-251    AC A0A663F2Z3.1
#=GS A0A091L581_CATAU/71-175     AC A0A091L581.1
#=GS S7MQA2_MYOBR/15-124         AC S7MQA2.1
#=GS A0A3Q3BGA5_KRYMA/19-131     AC A0A3Q3BGA5.1
#=GS A0A672IEJ7_SALFA/33-142     AC A0A672IEJ7.1
#=GS A0A2I0MUV1_COLLI/106-217    AC A0A2I0MUV1.1
#=GS A0A091VWY9_OPIHO/71-158     AC A0A091VWY9.1
#=GS A0A151MUT8_ALLMI/103-213    AC A0A151MUT8.1
#=GS A0A0P7UTI2_SCLFO/25-135     AC A0A0P7UTI2.1
#=GS A0A2P8YCI2_BLAGE/18-121     AC A0A2P8YCI2.1
#=GS A0A5N5K1K0_PANHP/122-234    AC A0A5N5K1K0.1
#=GS A0A2K6GQ94_PROCO/23-123     AC A0A2K6GQ94.1
#=GS A0A091EUS3_CORBR/49-160     AC A0A091EUS3.1
#=GS A0A3P4Q064_GULGU/50-160     AC A0A3P4Q064.1
#=GS A0A485MDI0_LYNPA/132-241    AC A0A485MDI0.1
#=GS H3D1Y4_TETNG/3-99           AC H3D1Y4.1
#=GS A0A0V0X7F4_9BILA/151-276    AC A0A0V0X7F4.1
#=GS A0A2I0M2X5_COLLI/39-139     AC A0A2I0M2X5.1
#=GS A0A151MJ34_ALLMI/4-90       AC A0A151MJ34.1
#=GS A0A3Q7V4K9_URSAR/78-189     AC A0A3Q7V4K9.1
#=GS A0A401T1B1_CHIPU/48-159     AC A0A401T1B1.1
#=GS D2HG20_AILME/78-189         AC D2HG20.1
#=GS A0A3P9BY68_9CICH/19-122     AC A0A3P9BY68.1
#=GS G5BWE1_HETGA/71-181         AC G5BWE1.1
#=GS A0A2K5NYY2_CERAT/76-188     AC A0A2K5NYY2.1
#=GS A0A5F8GJQ6_MONDO/67-177     AC A0A5F8GJQ6.1
#=GS A0A1S3GSJ8_DIPOR/22-122     AC A0A1S3GSJ8.1
#=GS A0A653DNA3_CALMS/14-128     AC A0A653DNA3.1
#=GS A0A672V9Q2_STRHB/143-251    AC A0A672V9Q2.1
#=GS L8J0A0_9CETA/135-244        AC L8J0A0.1
#=GS H2VAD0_TAKRU/63-173         AC H2VAD0.3
#=GS A0A2K5PTD0_CEBCA/135-244    AC A0A2K5PTD0.1
#=GS A0A444UM35_ACIRT/1539-1646  AC A0A444UM35.1
#=GS A0A3P9P206_POERE/52-184     AC A0A3P9P206.1
#=GS A0A672H643_SALFA/63-168     AC A0A672H643.1
#=GS A0A1W4W3Y0_AGRPL/35-142     AC A0A1W4W3Y0.1
#=GS A0A1U7R4I1_MESAU/73-183     AC A0A1U7R4I1.1
#=GS A0A1S3AGY2_ERIEU/65-165     AC A0A1S3AGY2.1
#=GS A0A5A9PSN3_9TELE/51-161     AC A0A5A9PSN3.1
#=GS A0A3M6T8A2_9CNID/205-310    AC A0A3M6T8A2.1
#=GS A0A093HNS9_STRCA/142-250    AC A0A093HNS9.1
#=GS A0A091Q4F6_LEPDC/143-251    AC A0A091Q4F6.1
#=GS A0A5J5ML26_MUNRE/22-122     AC A0A5J5ML26.1
#=GS A0A671YYF7_SPAAU/47-165     AC A0A671YYF7.1
#=GS A0A3Q3L222_9TELE/131-242    AC A0A3Q3L222.1
#=GS A0A151IA68_9HYME/100-215    AC A0A151IA68.1
#=GS A0A444UMS9_ACIRT/258-368    AC A0A444UMS9.1
#=GS A0A087QSG1_APTFO/143-251    AC A0A087QSG1.1
#=GS A0A094L8L4_ANTCR/140-248    AC A0A094L8L4.1
#=GS A0A0N4UI15_DRAME/65-155     AC A0A0N4UI15.1
#=GS A0A4V6AQ18_COLLU/128-243    AC A0A4V6AQ18.1
#=GS A0A667YZA9_9TELE/50-160     AC A0A667YZA9.1
#=GS Q7PJ83_ANOGA/7-118          AC Q7PJ83.4
#=GS A0A452EWT4_CAPHI/135-244    AC A0A452EWT4.1
#=GS A0A5N4AMQ5_PHOPY/22-133     AC A0A5N4AMQ5.1
#=GS A0A4C1W262_EUMVA/138-254    AC A0A4C1W262.1
#=GS A0A4W3JUR8_CALMI/141-249    AC A0A4W3JUR8.1
#=GS M3ZNN1_XIPMA/52-184         AC M3ZNN1.2
#=GS A0A653DPP9_CALMS/14-103     AC A0A653DPP9.1
#=GS Q171F9_AEDAE/20-137         AC Q171F9.1
#=GS A0A091ISS1_CALAN/143-251    AC A0A091ISS1.1
#=GS A0A2G9UWY1_TELCI/19-124     AC A0A2G9UWY1.1
#=GS A0A212D3B5_CEREH/31-131     AC A0A212D3B5.1
#=GS I3KNT3_ORENI/127-241        AC I3KNT3.2
#=GS A0A0N4V2H7_ENTVE/27-142     AC A0A0N4V2H7.1
#=GS U3J0F0_ANAPP/143-251        AC U3J0F0.1
#=GS A0A4U5UER0_COLLU/20-124     AC A0A4U5UER0.1
#=GS B0W9J5_CULQU/4-116          AC B0W9J5.1
#=GS E9GLP7_DAPPU/22-135         AC E9GLP7.1
#=GS U3JVD6_FICAL/124-232        AC U3JVD6.1
#=GS B0X0Y3_CULQU/10-117         AC B0X0Y3.1
#=GS A0A498MP64_LABRO/20-124     AC A0A498MP64.1
#=GS A0A3M0ISD3_HIRRU/171-270    AC A0A3M0ISD3.1
#=GS A0A3Q7VKD7_URSAR/50-160     AC A0A3Q7VKD7.1
#=GS A0A091U592_PHORB/143-251    AC A0A091U592.1
#=GS A0A2Y9IJX2_ENHLU/21-134     AC A0A2Y9IJX2.1
#=GS A0A093H7I5_STRCA/71-173     AC A0A093H7I5.1
#=GS A0A2K6ECM3_MACNE/57-157     AC A0A2K6ECM3.1
#=GS A0A1S3P4A2_SALSA/16-124     AC A0A1S3P4A2.1
#=GS A0A3N0YH70_ANAGA/44-149     AC A0A3N0YH70.1
#=GS A0A091UD24_PHORB/32-131     AC A0A091UD24.1
#=GS A0A5N5TLY6_9CRUS/42-157     AC A0A5N5TLY6.1
#=GS A0A2Y9GG82_NEOSC/132-241    AC A0A2Y9GG82.1
#=GS A0A310SSL9_9HYME/10-115     AC A0A310SSL9.1
#=GS A0A2K6ECL9_MACNE/23-123     AC A0A2K6ECL9.1
#=GS A0A383ZNZ1_BALAS/135-244    AC A0A383ZNZ1.1
#=GS A0A093GI18_DRYPU/31-131     AC A0A093GI18.1
#=GS A0A2Y9DUJ0_TRIMA/25-140     AC A0A2Y9DUJ0.1
#=GS A0A673ZS04_SALTR/68-178     AC A0A673ZS04.1
#=GS A0A067R9Y8_ZOONE/342-409    AC A0A067R9Y8.1
#=GS A0A238BYF7_9BILA/170-284    AC A0A238BYF7.1
#=GS A0A3P6QJH7_CYLGO/28-133     AC A0A3P6QJH7.1
#=GS A0A1S2ZMQ6_ERIEU/1-111      AC A0A1S2ZMQ6.1
#=GS C6SUP0_PEDHC/18-123         AC C6SUP0.1
#=GS A0A0A0AMS3_CHAVO/71-181     AC A0A0A0AMS3.1
#=GS A0A3B1K9K4_ASTMX/29-137     AC A0A3B1K9K4.1
#=GS A0A2Y9K3Q7_ENHLU/50-160     AC A0A2Y9K3Q7.1
#=GS A0A091M7J6_CARIC/49-160     AC A0A091M7J6.1
#=GS NBL1_XENTR/23-122           AC Q6DF53.1
#=GS I3NCG8_ICTTR/71-181         AC I3NCG8.1
#=GS A0A484CHJ7_PERFV/52-184     AC A0A484CHJ7.1
#=GS W5PNA7_SHEEP/14-124         AC W5PNA7.1
#=GS A0A2K5RMB4_CEBCA/57-157     AC A0A2K5RMB4.1
#=GS A0A663DT65_AQUCH/71-181     AC A0A663DT65.1
#=GS F1S9G0_PIG/49-159           AC F1S9G0.1
#=GS A0A091H6M0_BUCRH/71-175     AC A0A091H6M0.1
#=GS A0A5A9PIW7_9TELE/127-237    AC A0A5A9PIW7.1
#=GS A0A5N4CJ16_CAMDR/49-161     AC A0A5N4CJ16.1
#=GS V9LCQ3_CALMI/29-129         AC V9LCQ3.1
#=GS R7TDN8_CAPTE/59-123         AC R7TDN8.1
#=GS W5NA82_LEPOC/151-262        AC W5NA82.1
#=GS L5KAF3_PTEAL/4-113          AC L5KAF3.1
#=GS H0WFU0_OTOGA/71-181         AC H0WFU0.1
#=GS A0A3Q1ARX7_AMPOC/20-124     AC A0A3Q1ARX7.1
#=GS A0A485NA03_LYNPA/23-123     AC A0A485NA03.1
#=GS A0A1U7S9L2_ALLSI/103-210    AC A0A1U7S9L2.1
#=GS A0A0V1ABN5_9BILA/153-279    AC A0A0V1ABN5.1
#=GS A0A337SGF9_FELCA/77-189     AC A0A337SGF9.1
#=GS A0A3P8UJ15_CYNSE/20-124     AC A0A3P8UJ15.1
#=GS A0A3P4RSP7_GULGU/22-122     AC A0A3P4RSP7.1
#=GS G1TUM4_RABIT/127-237        AC G1TUM4.2
#=GS A0A1V9XK96_9ACAR/10-101     AC A0A1V9XK96.1
#=GS A0A5A9NTN7_9TELE/83-193     AC A0A5A9NTN7.1
#=GS A0A3P7I6Y0_STRVU/1-48       AC A0A3P7I6Y0.1
#=GS G3VCY2_SARHA/24-123         AC G3VCY2.1
#=GS A0A0T6AY08_9SCAR/16-129     AC A0A0T6AY08.1
#=GS A0A673UC07_SURSU/131-241    AC A0A673UC07.1
#=GS A0A0K0FND7_STRVS/80-195     AC A0A0K0FND7.1
#=GS A0A182GFW7_AEDAL/104-256    AC A0A182GFW7.1
#=GS A0A452RY82_URSAM/22-122     AC A0A452RY82.1
#=GS A0A2A2LS04_9BILA/10-85      AC A0A2A2LS04.1
#=GS A0A2B4RDT1_STYPI/22-124     AC A0A2B4RDT1.1
#=GS A0A091QVN0_MERNU/143-251    AC A0A091QVN0.1
#=GS A0A401T2R0_CHIPU/237-337    AC A0A401T2R0.1
#=GS A0A3Q1HHL6_ANATE/128-232    AC A0A3Q1HHL6.1
#=GS A0A0Q3MBA7_AMAAE/143-251    AC A0A0Q3MBA7.1
#=GS A0A3P6SEH4_LITSI/52-166     AC A0A3P6SEH4.1
#=GS A0A3Q4G2R8_NEOBR/62-172     AC A0A3Q4G2R8.1
#=GS A0A091EC65_FUKDA/178-288    AC A0A091EC65.1
#=GS A0A340XWZ7_LIPVE/135-244    AC A0A340XWZ7.1
#=GS G1NQZ5_MELGA/71-181         AC G1NQZ5.1
#=GS G3TDR2_LOXAF/135-244        AC G3TDR2.1
#=GS A0A091QDW7_MERNU/71-181     AC A0A091QDW7.1
#=GS A0A0Q3UQZ7_AMAAE/71-181     AC A0A0Q3UQZ7.1
#=GS A0A093NLI9_PYGAD/71-163     AC A0A093NLI9.1
#=GS A0A5N4DAT7_CAMDR/22-122     AC A0A5N4DAT7.1
#=GS A0A158NKI9_ATTCE/22-124     AC A0A158NKI9.1
#=GS A0A0P7THY8_SCLFO/24-124     AC A0A0P7THY8.1
#=GS A0A3Q1IMG2_ANATE/69-179     AC A0A3Q1IMG2.1
#=GS A0A6R5ILE7_AEDAE/16-122     AC A0A6R5ILE7.1
#=GS A0A3Q3CUX8_HAPBU/24-134     AC A0A3Q3CUX8.1
#=GS A0A2K5LNC8_CERAT/28-123     AC A0A2K5LNC8.1
#=GS A0A088AMF5_APIME/18-132     AC A0A088AMF5.1
#=GS A0A091ENS9_CORBR/143-251    AC A0A091ENS9.1
#=GS A0A091GQK3_9AVES/49-160     AC A0A091GQK3.1
#=GS G3H6M6_CRIGR/50-160         AC G3H6M6.1
#=GS A0A091I1B2_CALAN/71-181     AC A0A091I1B2.1
#=GS A0A6A5EPS6_PERFL/164-276    AC A0A6A5EPS6.1
#=GS A0A182E1R6_ONCOC/92-213     AC A0A182E1R6.1
#=GS A0A091RDN0_9GRUI/50-161     AC A0A091RDN0.1
#=GS A0A4D9EWI3_9SAUR/71-181     AC A0A4D9EWI3.1
#=GS A0A3Q7WIZ1_URSAR/22-122     AC A0A3Q7WIZ1.1
#=GS H2NMP6_PONAB/71-181         AC H2NMP6.1
#=GS A0A0N4YF27_NIPBR/7-80       AC A0A0N4YF27.1
#=GS A0A5N5LAW0_PANHP/76-186     AC A0A5N5LAW0.1
#=GS E0VGW1_PEDHC/11-117         AC E0VGW1.1
#=GS A0A673C2Q3_9TELE/52-125     AC A0A673C2Q3.1
#=GS A0A0V0YAD1_TRIPS/160-277    AC A0A0V0YAD1.1
#=GS A0A2K5LNE2_CERAT/63-158     AC A0A2K5LNE2.1
#=GS A0A3Q3VUG0_MOLML/56-166     AC A0A3Q3VUG0.1
#=GS A0A093HGS7_GAVST/49-160     AC A0A093HGS7.1
#=GS A3KFI2_HUMAN/23-109         AC A3KFI2.1
#=GS A0A3Q3XMY7_MOLML/13-125     AC A0A3Q3XMY7.1
#=GS A0A2K5J2N2_COLAP/23-123     AC A0A2K5J2N2.1
#=GS A0A093IAS7_FULGA/49-160     AC A0A093IAS7.1
#=GS H0YXK3_TAEGU/53-168         AC H0YXK3.1
#=GS A0A087XSD8_POEFO/27-144     AC A0A087XSD8.1
#=GS A0A498LK72_LABRO/472-582    AC A0A498LK72.1
#=GS A0A6G0YH65_APHCR/34-143     AC A0A6G0YH65.1
#=GS A0A087YKH9_POEFO/52-165     AC A0A087YKH9.1
#=GS A0A226NGK9_CALSU/49-160     AC A0A226NGK9.1
#=GS W5JVV4_ANODA/28-141         AC W5JVV4.1
#=GS A0A3Q3MA22_9TELE/51-182     AC A0A3Q3MA22.1
#=GS A0A016UDK1_9BILA/100-208    AC A0A016UDK1.1
#=GS A0A6G0UXC1_9BILA/785-893    AC A0A6G0UXC1.1
#=GS A0A3Q0E7H8_CARSF/23-123     AC A0A3Q0E7H8.1
#=GS A0A151N3J3_ALLMI/203-308    AC A0A151N3J3.1
#=GS A0A151JB20_9HYME/22-124     AC A0A151JB20.1
#=GS A0A3Q3AYA9_CHICK/49-160     AC A0A3Q3AYA9.1
#=GS W5MMX0_LEPOC/130-235        AC W5MMX0.1
#=GS DAND5_HUMAN/76-188          AC Q8N907.1
#=GS A0A401RR94_CHIPU/2-89       AC A0A401RR94.1
#=GS C3YH06_BRAFL/30-140         AC C3YH06.1
#=GS A0RZD3_TRICA/21-130         AC A0RZD3.1
#=GS A0A672VFC2_STRHB/48-159     AC A0A672VFC2.1
#=GS U3K7P6_FICAL/23-123         AC U3K7P6.1
#=GS A0A2K5US66_MACFA/50-160     AC A0A2K5US66.1
#=GS A0A5C6PIN7_9TELE/52-184     AC A0A5C6PIN7.1
#=GS R7TQD0_CAPTE/3-110          AC R7TQD0.1
#=GS A0A091D7D5_FUKDA/49-160     AC A0A091D7D5.1
#=GS A0A6A5ELV1_PERFL/1019-1129  AC A0A6A5ELV1.1
#=GS A0A433T0R7_ELYCH/30-141     AC A0A433T0R7.1
#=GS A0A553PZC0_9TELE/108-220    AC A0A553PZC0.1
#=GS A0A1S3AJM3_ERIEU/137-246    AC A0A1S3AJM3.1
#=GS BURS_ANOGA/23-128           AC Q66Q82.1
#=GS A0A091T6A6_PHALP/49-160     AC A0A091T6A6.1
#=GS G3T8B8_LOXAF/71-181         AC G3T8B8.1
#=GS A0A2K6MMY5_RHIBE/76-188     AC A0A2K6MMY5.1
#=GS A0A151X5V5_9HYME/100-209    AC A0A151X5V5.1
#=GS V8P7J1_OPHHA/114-224        AC V8P7J1.1
#=GS DAND5_MOUSE/76-184          AC Q76LW6.1
#=GS B7PJB3_IXOSC/14-118         AC B7PJB3.1
#=GS A0A674BSK6_SALTR/54-164     AC A0A674BSK6.1
#=GS A0A2K6EYN8_PROCO/70-184     AC A0A2K6EYN8.1
#=GS A0A0P7V8E5_SCLFO/49-159     AC A0A0P7V8E5.1
#=GS A0A4W6EHN1_LATCA/26-142     AC A0A4W6EHN1.1
#=GS A0A341D821_NEOAA/77-184     AC A0A341D821.1
#=GS A0A673ZD61_SALTR/16-124     AC A0A673ZD61.1
#=GS A0A401PCC5_SCYTO/76-186     AC A0A401PCC5.1
#=GS G3NRV7_GASAC/72-182         AC G3NRV7.1
#=GS A0A2I3HLU6_NOMLE/50-160     AC A0A2I3HLU6.1
#=GS A0A452QD55_URSAM/127-237    AC A0A452QD55.1
#=GS A0A096NPC8_PAPAN/23-123     AC A0A096NPC8.2
#=GS A0A671EQM4_RHIFE/133-242    AC A0A671EQM4.1
#=GS M7BVA2_CHEMY/2286-2394      AC M7BVA2.1
#=GS A0A4Z2FMM5_9TELE/19-117     AC A0A4Z2FMM5.1
#=GS A0A2I2Z433_GORGO/57-157     AC A0A2I2Z433.1
#=GS A0A2U3YL33_LEPWE/132-241    AC A0A2U3YL33.1
#=GS A0A5E4QTJ9_9NEOP/3-98       AC A0A5E4QTJ9.1
#=GS E2QUD8_CANLF/78-189         AC E2QUD8.1
#=GS A0A093QCT6_9PASS/71-181     AC A0A093QCT6.1
#=GS A0A093FA51_TYTAL/48-151     AC A0A093FA51.1
#=GS A0A016UE08_9BILA/100-210    AC A0A016UE08.1
#=GS A0A6G1AP48_CROCR/71-181     AC A0A6G1AP48.1
#=GS A0A6G0ZAQ5_APHCR/19-129     AC A0A6G0ZAQ5.1
#=GS GREM2_MOUSE/50-160          AC O88273.1
#=GS GREM2_MOUSE/50-160          DR PDB; 5HK5 H; 50-160;
#=GS GREM2_MOUSE/50-160          DR PDB; 5HK5 G; 50-160;
#=GS GREM2_MOUSE/50-160          DR PDB; 5HK5 E; 50-160;
#=GS GREM2_MOUSE/50-160          DR PDB; 4JPH D; 50-160;
#=GS GREM2_MOUSE/50-160          DR PDB; 5HK5 F; 50-160;
#=GS GREM2_MOUSE/50-160          DR PDB; 4JPH A; 50-160;
#=GS GREM2_MOUSE/50-160          DR PDB; 4JPH C; 60-160;
#=GS GREM2_MOUSE/50-160          DR PDB; 4JPH B; 50-160;
#=GS A0A5N3XMU5_MUNRE/71-181     AC A0A5N3XMU5.1
#=GS A0A091PC89_LEPDC/71-175     AC A0A091PC89.1
#=GS BURS_AEDAE/21-128           AC P85316.1
#=GS A0A2F0B5M0_ESCRO/22-122     AC A0A2F0B5M0.1
#=GS A0A674CBL6_SALTR/59-169     AC A0A674CBL6.1
#=GS A0A4U1FS04_MONMO/22-122     AC A0A4U1FS04.1
#=GS D3ZGN3_RAT/74-183           AC D3ZGN3.1
#=GS G0NH36_CAEBE/238-351        AC G0NH36.1
#=GS A7RW37_NEMVE/1-93           AC A7RW37.1
#=GS E1BD70_BOVIN/14-124         AC E1BD70.1
#=GS A0A674CJ16_SALTR/68-178     AC A0A674CJ16.1
#=GS A0A0P7UX15_SCLFO/48-159     AC A0A0P7UX15.1
#=GS A0A3Q2TTE0_CHICK/316-427    AC A0A3Q2TTE0.1
#=GS A0A3L8SX70_CHLGU/71-181     AC A0A3L8SX70.1
#=GS A0A556TWW5_BAGYA/48-158     AC A0A556TWW5.1
#=GS D2H4S2_AILME/19-124         AC D2H4S2.1
#=GS A0A2Y9FNM2_PHYMC/134-244    AC A0A2Y9FNM2.1
#=GS H3A159_LATCH/147-256        AC H3A159.1
#=GS A0A2A4K923_HELVI/18-129     AC A0A2A4K923.1
#=GS L5MGD9_MYODS/136-245        AC L5MGD9.1
#=GS A0A3P8UMW9_CYNSE/67-171     AC A0A3P8UMW9.1
#=GS A0A6Q2YCY8_ESOLU/15-117     AC A0A6Q2YCY8.1
#=GS A0A2U9CDG4_SCOMX/139-271    AC A0A2U9CDG4.1
#=GS A0A5S7WI71_MACMU/127-237    AC A0A5S7WI71.1
#=GS A0A1W4WQA4_AGRPL/21-126     AC A0A1W4WQA4.1
#=GS A0A0V0VJN8_9BILA/150-277    AC A0A0V0VJN8.1
#=GS A0A093HZX2_STRCA/49-160     AC A0A093HZX2.1
#=GS G1Q507_MYOLU/23-123         AC G1Q507.1
#=GS A0A4U5VFM5_COLLU/69-179     AC A0A4U5VFM5.1
#=GS G1KVG4_ANOCA/65-181         AC G1KVG4.1
#=GS H3C0F2_TETNG/129-244        AC H3C0F2.1
#=GS A0A087VRZ2_BALRE/143-251    AC A0A087VRZ2.1
#=GS A0A3M0JH15_HIRRU/71-181     AC A0A3M0JH15.1
#=GS A0A5J5CNG1_9PERO/69-179     AC A0A5J5CNG1.1
#=GS A0A553Q7X7_9TELE/37-96      AC A0A553Q7X7.1
#=GS A0A091CQE7_FUKDA/75-186     AC A0A091CQE7.1
#=GS A0A484GY64_SOUCH/71-181     AC A0A484GY64.1
#=GS A0A2I0TY14_LIMLA/49-160     AC A0A2I0TY14.1
#=GS A0A2I3HMH1_NOMLE/135-244    AC A0A2I3HMH1.1
#=GS D2H275_AILME/30-130         AC D2H275.1
#=GS A0A1S3N4K5_SALSA/51-176     AC A0A1S3N4K5.1
#=GS A0A498S8J7_ACAVI/119-240    AC A0A498S8J7.1
#=GS A0A2U3V487_TURTR/22-122     AC A0A2U3V487.1
#=GS B0BN87_RAT/135-244          AC B0BN87.1
#=GS A0A2I0UTD4_LIMLA/143-251    AC A0A2I0UTD4.1
#=GS A0A1A6HFZ5_NEOLE/72-183     AC A0A1A6HFZ5.1
#=GS Q17JY7_AEDAE/139-291        AC Q17JY7.1
#=GS I3N5H1_ICTTR/50-160         AC I3N5H1.1
#=GS A0A5F4CZS0_CANLF/22-122     AC A0A5F4CZS0.1
#=GS I3L016_ORENI/123-233        AC I3L016.2
#=GS I3MRI0_ICTTR/57-169         AC I3MRI0.1
#=GS A0A3Q1EHT7_9TELE/52-182     AC A0A3Q1EHT7.1
#=GS A0A444TZS7_ACIRT/83-189     AC A0A444TZS7.1
#=GS A0A2T7PAC9_POMCA/72-184     AC A0A2T7PAC9.1
#=GS G0NGX1_CAEBE/21-120         AC G0NGX1.1
#=GS A0A3P8UMY6_CYNSE/19-123     AC A0A3P8UMY6.1
#=GS A0A5E4M6B4_9HEMI/31-139     AC A0A5E4M6B4.1
#=GS A0A5E4MJ59_9HEMI/18-134     AC A0A5E4MJ59.1
#=GS G1NRR1_MELGA/49-160         AC G1NRR1.2
#=GS A0A1Y3B432_EURMA/87-187     AC A0A1Y3B432.1
#=GS B0WSH1_CULQU/42-140         AC B0WSH1.1
#=GS A0A084WD69_ANOSI/275-421    AC A0A084WD69.1
#=GS A0A0A0AX61_CHAVO/143-251    AC A0A0A0AX61.1
#=GS A0A091JW64_COLST/40-151     AC A0A091JW64.1
#=GS A0A3Q1LX74_BOVIN/127-237    AC A0A3Q1LX74.1
#=GS G3WF61_SARHA/50-160         AC G3WF61.1
#=GS A0A3Q1EY76_9TELE/27-142     AC A0A3Q1EY76.1
#=GS U4UXP2_DENPD/32-144         AC U4UXP2.1
#=GS A0A2I3RC67_PANTR/57-157     AC A0A2I3RC67.1
#=GS A0A3Q3LX70_9TELE/29-142     AC A0A3Q3LX70.1
#=GS S7MYP4_MYOBR/659-768        AC S7MYP4.1
#=GS M7BEX3_CHEMY/71-181         AC M7BEX3.1
#=GS A0A4W2G6F6_BOBOX/127-237    AC A0A4W2G6F6.1
#=GS A0A096P1I6_PAPAN/137-246    AC A0A096P1I6.1
#=GS CER1_MOUSE/135-244          AC O55233.1
#=GS A0A5E4BPF3_MARMO/71-181     AC A0A5E4BPF3.1
#=GS A0A3R7MBC0_PENVA/34-139     AC A0A3R7MBC0.1
#=GS A0A3P7U488_9BILA/28-158     AC A0A3P7U488.1
#=GS A0A5E4BSK7_MARMO/919-1028   AC A0A5E4BSK7.1
#=GS A0A672FGL4_SALFA/64-174     AC A0A672FGL4.1
#=GS R0LGE4_ANAPL/32-131         AC R0LGE4.1
#=GS A0A3Q7WBY3_URSAR/133-242    AC A0A3Q7WBY3.1
#=GS B0W0F5_CULQU/143-292        AC B0W0F5.1
#=GS A0A2Y9STA6_PHYMC/22-119     AC A0A2Y9STA6.1
#=GS A0A2Y9GJ55_NEOSC/22-122     AC A0A2Y9GJ55.1
#=GS A0A4W5N4U3_9TELE/72-182     AC A0A4W5N4U3.1
#=GS A0A1L8HY40_XENLA/211-316    AC A0A1L8HY40.1
#=GS A0A093C748_9AVES/143-251    AC A0A093C748.1
#=GS A0A091VFN4_NIPNI/143-251    AC A0A091VFN4.1
#=GS W5ML90_LEPOC/20-123         AC W5ML90.1
#=GS A0A094KLW4_ANTCR/49-160     AC A0A094KLW4.1
#=GS S7Q8L6_MYOBR/6-117          AC S7Q8L6.1
#=GS A0A4W4FCC7_ELEEL/47-158     AC A0A4W4FCC7.1
#=GS A0A1U7Q345_MESAU/71-181     AC A0A1U7Q345.1
#=GS A0A0D9S8D7_CHLSB/23-123     AC A0A0D9S8D7.1
#=GS A0A3P8UXP9_CYNSE/69-179     AC A0A3P8UXP9.1
#=GS J9LHE2_ACYPI/28-132         AC J9LHE2.2
#=GS A0A4Z2J5B2_9TELE/1-38       AC A0A4Z2J5B2.1
#=GS A0A384D0C7_URSMA/71-181     AC A0A384D0C7.1
#=GS M3YW73_MUSPF/59-169         AC M3YW73.1
#=GS H9GK33_ANOCA/45-144         AC H9GK33.2
#=GS A0A0P7Z6M3_SCLFO/99-213     AC A0A0P7Z6M3.1
#=GS A0A1N8XHL8_CHICK/40-139     AC A0A1N8XHL8.1
#=GS C6SUP2_AEDAE/7-117          AC C6SUP2.1
#=GS H0X5P7_OTOGA/135-244        AC H0X5P7.1
#=GS A0A1S3Q7B7_SALSA/141-260    AC A0A1S3Q7B7.1
#=GS A0A665TKX0_ECHNA/66-176     AC A0A665TKX0.1
#=GS G5BGU0_HETGA/41-154         AC G5BGU0.1
#=GS A0A6A1QET5_BALPH/187-296    AC A0A6A1QET5.1
#=GS R0KDQ4_ANAPL/71-181         AC R0KDQ4.1
#=GS A0A452SBH7_URSAM/133-242    AC A0A452SBH7.1
#=GS L9L8C5_TUPCH/235-345        AC L9L8C5.1
#=GS A0A2K5X5U6_MACFA/76-188     AC A0A2K5X5U6.1
#=GS A0A498LLI6_LABRO/126-232    AC A0A498LLI6.1
#=GS H3B020_LATCH/48-159         AC H3B020.1
#=GS A0A091U7R9_PHALP/143-251    AC A0A091U7R9.1
#=GS A0A1V4J4N6_PATFA/143-251    AC A0A1V4J4N6.1
#=GS U3J654_ANAPP/22-122         AC U3J654.2
#=GS A0A091JQM8_COLST/143-251    AC A0A091JQM8.1
#=GS A0A6A1Q373_BALPH/22-122     AC A0A6A1Q373.1
#=GS A0A3P9P1G4_POERE/57-167     AC A0A3P9P1G4.1
#=GS A0A084VBL1_ANOSI/14-118     AC A0A084VBL1.1
#=GS A0A556TSI0_BAGYA/65-175     AC A0A556TSI0.1
#=GS A0A2U9BFP2_SCOMX/100-202    AC A0A2U9BFP2.1
#=GS A0A2A2J7E7_9BILA/398-509    AC A0A2A2J7E7.1
#=GS A0A1Y1NG66_PHOPY/22-135     AC A0A1Y1NG66.1
#=GS A0A672JC15_SALFA/20-124     AC A0A672JC15.1
#=GS A0A1S3EZU9_DIPOR/1-111      AC A0A1S3EZU9.1
#=GS A0A1A6H0H5_NEOLE/77-187     AC A0A1A6H0H5.1
#=GS A0A3Q3GN99_9LABR/69-179     AC A0A3Q3GN99.1
#=GS A0A091RQS2_NESNO/143-251    AC A0A091RQS2.1
#=GS L9L7G5_TUPCH/50-87          AC L9L7G5.1
#=GS T0MJB8_CAMFR/121-220        AC T0MJB8.1
#=GS F7CAQ1_MONDO/57-167         AC F7CAQ1.2
#=GS A3KFI1_HUMAN/57-128         AC A3KFI1.1
#=GS A0A5F4DI85_CANLF/46-146     AC A0A5F4DI85.1
#=GS A0A091LEB7_CATAU/32-131     AC A0A091LEB7.1
#=GS A0A384CLX3_URSMA/38-122     AC A0A384CLX3.1
#=GS A0A401PD07_SCYTO/62-172     AC A0A401PD07.1
#=GS A0A131ZVK7_SARSC/1-95       AC A0A131ZVK7.1
#=GS A0A099YSC4_TINGU/71-181     AC A0A099YSC4.1
#=GS V9KZI4_CALMI/59-169         AC V9KZI4.1
#=GS A0A151J5U8_9HYME/51-160     AC A0A151J5U8.1
#=GS A0A1S3WQW7_ERIEU/23-123     AC A0A1S3WQW7.1
#=GS A0A3P8XMB6_ESOLU/70-180     AC A0A3P8XMB6.1
#=GS A0A455B469_PHYMC/22-142     AC A0A455B469.1
#=GS A0A6A4IWN9_APOLU/25-136     AC A0A6A4IWN9.1
#=GS A8Y458_CAEBR/23-121         AC A8Y458.1
#=GS B4HM41_DROSE/28-141         AC B4HM41.1
#=GS A0A091HDL3_BUCRH/31-132     AC A0A091HDL3.1
#=GS H9G2Y0_CAEEL/1-93           AC H9G2Y0.1
#=GS A0A670JPV4_PODMU/133-240    AC A0A670JPV4.1
#=GS A0A671G2G2_RHIFE/78-189     AC A0A671G2G2.1
#=GS A0A090L3R2_STRRB/10-126     AC A0A090L3R2.1
#=GS W5PWU0_SHEEP/135-244        AC W5PWU0.1
#=GS A0A286ZLG5_PIG/212-311      AC A0A286ZLG5.1
#=GS W2TMF3_NECAM/3-101          AC W2TMF3.1
#=GS A0A091JZ80_COLST/32-131     AC A0A091JZ80.1
#=GS B5SNL4_OTOGA/15-124         AC B5SNL4.1
#=GS A0A452RKD5_URSAM/78-189     AC A0A452RKD5.1
#=GS A0A1W4XBT8_AGRPL/108-223    AC A0A1W4XBT8.1
#=GS A0A1D5Q2D2_MACMU/23-123     AC A0A1D5Q2D2.2
#=GS A0A4W5PMC6_9TELE/44-152     AC A0A4W5PMC6.1
A0A3Q2DAN9_CYPVA/71-181                ......................................................d-EVLESSQE-....ALH.IT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................AFQ.SCSFCKPRKFK.PV...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
H2TK82_TAKRU/18-127                    ...................................falcsaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCLP.QSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......P-.........-.D...S...P..N.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A3P8S7J2_AMPPE/52-182                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSHG...QSrghgsgsg............................rknhnkvqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A2Y9LQI7_DELLE/24-124                .................................................lalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------igsslvleiqtwslsrdgsqvrhqhvqdkklc..................
A0A3S2TY35_ORYJA/26-142                ...................................vqsassnkardnghqhlsdp----------....---.--...--...--..-D...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.SCSCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
B7Q6G3_IXOSC/54-164                    ........................................gravvvrdhrrsppp----------....---.--...--...--..-R...RDWCRTGSLV.......Q.RVR.....E..P...GCRT.ALLRN......R.YCYGQCK....SFY.VPR....E.H....A....ANGS...AAg...........................................gAFE.SCAACRPVKFR.SV...........RLTF...V.C......PG.........Q.V...P...P..M.R...K...R...T...L....H....R....V.....H.....RCRCLA-v.................................................
B7ZQZ5_XENLA/69-179                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..D...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................SFQ.SCSFCKPKKFT.TM...........VVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...I....T....R....V.....K.....QCRCIS-i.................................................
A0A1S3HHH5_LINUN/19-125                .......................................gqdahpplqsivfhse----------....---.--...--...--..-S...HTWCESRPIQ.......Q.ILT.....Q..P...GCES.QSVEN......K.VCVGQCY....SYS.VPN....T.L....P....SQNA...-G.............................................LLQ.RHDVCKPARAR.WE...........KVTL...Q.C......A-.........-.N...G...H..M.L...P...K...F...V....Q....I....I.....E.....ECACAS-c.................................................
A0A091SPD9_PELCR/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....L.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A556TKY2_BAGYA/122-233               .....................................................qr--VMQKSEPSk.eiLSL.PF...NP...KD..AA...TQSCTALPFT.......Q.RIT.....E..E...GCEP.ITVHN......K.LCFGQCS....SMF.VPP....N.G....K....SSMH...--.............................................LGP.SCSRCGPSRTR.IV...........HVPM...H.C......--.........-.G...S...Q..V.R...E...K...R...V....I....L....V.....E.....ECKCET-g.................................................
A0A091U376_PHORB/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
G1KD58_ANOCA/53-170                    ..............................................netmnnraq---------QgervPQV.SL...NR...ME..PL...EFSCREVYST.......R.YVT.....E..G...LCRSiKPIRE......L.VCSGQCL...pAHL.LPN....S.I....G....KGKW...WR.............................................QNA.LDYRCIPAHSR.SL...........RVQL...T.C......P-.........-.N...E...D..M.R...T...I...K...I....R....S....I.....T.....ACKCKR-y.................................................
A0A0N5D677_THECL/68-182                .....................................kealqqvnqevslgrldd----------....---.--...--...-S..RP...AAHCEGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TV...........EVKL...D.C......PR.........K.N...P...R..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A2Y9N812_DELLE/187-296               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPDKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....ECQCKV-k.................................................
F7HWY3_CALJA/57-157                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091LKK8_9GRUI/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2U3W7A8_ODORO/132-241               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..S.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
L5JSM4_PTEAL/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVG.....E..E...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2I4BT62_9TELE/61-171                ......................................................d-EVLESSQE-....ALL.VT...ER...RY..LR...LDWCKTQPLK.......Q.SIQ.....E..D...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.A....H....QDGS...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...L.C......PG.........R.T...P...S..T.R...R...K...R...V....Q....R....V.....K.....QCRCAT-v.................................................
A0A6G1BFF7_CROCR/79-189                ..............................................qhgpeaapp----------....VSL.PL...DP...HE..VT...RERCRAVPFT.......Q.VVS.....Q..P...GCTA.VRLRN......H.LCFGHCS....SLY.VPS....L.G....P....T---...--.............................................PLI.LCNSCVPARKR.WT...........PVVL...W.C......RA.........S.S...P...G..S.R...R...RvktS...T....V....L....V.....E.....GCQCS--pk................................................
A0A674DXM2_SALTR/141-260               ....................................qramdksdhsktmsmslpl----------....---.-S...LK...DS..AN...RQSCAAVPFT.......Q.RIT.....S..E...GCDA.VTVHN......K.LCFGQCS....SLF.VPS....G.W....E....SARL...TGag.........................................ghRRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
H3DI09_TETNG/52-167                    ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....KSPNk.aQE.............................................PFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A0R4IYE7_DANRE/91-201                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........SFTL...S.C......PD.........Q.Q...P...P..T.R...K...K...R...V....Q....R....V.....K.....QCRCIS-i.................................................
A0A3Q3L2L7_9LABR/126-242               ..................................................wqrai----NKGEK-....MHL.PI...NL...KD..T-...KQTCTAIPFT.......Q.HVT.....A..E...GCST.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FAGP...GSsgt......................................gslrHRA.PCSRCAPSKSH.TV...........TVPL...R.C......--.........-.G...A...E..V.R...E...R...R...L....V....V....V.....E.....ECKCET-g.................................................
A0A665UAU1_ECHNA/26-142                ...................................vqsassnkasdnshphlgds----------....---.--...--...--..-D...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A2J7QXV2_9NEOP/22-127                ............................................avvsrtgakda----------....---.--...--...--..WE...RPGCHKVGHT.......R.KIS.....I..P...DCVE.FHITT......N.ACRGYCE....SWA.VPS....A.I....D....TLRV...NPh..........................................qtITS.VGQCCNIMDTE.DV...........EVRV...M.C......L-.........-.-...D...G..T.R...D...L...V...F....K....S....A.....K.....SCSCY--hc................................................
A0A2Y9R091_TRIMA/22-128                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQNsdlsshR.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1S3Q6A8_SALSA/141-260               ....................................qramdksdhsktmsmslpl----------....---.-S...LK...DS..AN...RQSCAAVPFT.......Q.RIT.....S..E...GCDA.VTVHN......K.LCFGQCS....SLF.VPS....G.W....E....SARL...TGag.........................................ghRRA.PCSRCAPSKAH.KV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
E2BTT5_HARSA/1-92                      .......................................................----------....---.--...--...--..--...-DECQATRVI.......H.FLE.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCTCCQISGER.EA...........SVSL...F.C......PR.........-.-...A...K..P.G...E...K...K...F....R....K....VitkapL.....ECMC---rpc...............................................
A0A3N0YJZ3_ANAGA/126-236               ................................................qkvmhks----ERSKEA....VAL.RI...NP...KD..MS...KQSCAAVPFT.......Q.RIT.....E..D...GCET.VTVHN......H.LCYGQCS....SMF.VPS....S.G....E....ARA-...--.............................................QGA.HCTRCGPSKSR.SV...........IVPL...R.C......--.........-.G...T...E..V.R...E...R...R...V....M....V....V.....E.....ECKCET-s.................................................
A0A3Q2W9Q5_HAPBU/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....RCSCQS-c.................................................
A0A6A4VPZ1_AMPAM/39-166                .......................................hrtqslelekigqlea----------....---.--...--...FE..YD...EPSCRLVGHT.......Q.RVV.....V..P...GCLP.LALTV......N.ACQGACE....SYA.LPS....S.W....A....TMKL...NPrhll....................................tsvsqC--.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------cnimetkndtglvprhlitdkeecspqlaslhqqmaqlnlpgpdadikel
E9FYK9_DAPPU/3-105                     ................................................lfvglvs----------....---.--...--...-V..IR...ADECQLTPVI.......H.VLQ.....Y..P...GCIP.KPIPS......F.ACTGKCT....SYV.QVS....G.S....K....L---...WQ.............................................TER.SCMCCQESGER.EA...........TVSL...L.C......PKa......apG.E...P...K..L.R...R...V...V...T....R....A....P.....V.....DCMC---rpc...............................................
A0A226MMR2_CALSU/142-247               ................................................hfmlrkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.V--.....-..-...---R.TGVLF......P.ACYNQQPkihgSFH.IPG....P.D....D....H---...--.............................................LYT.SCSKCLPTKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECNCET-q.................................................
A0A2K6CB62_MACNE/186-295               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A226N9Y5_CALSU/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1L8GDG5_XENLA/1-85                  ......................................................m----------....---.--...--...--..-A...EETCSARKLK.......K.VLR.....D..G...SCSL.-DVEL......T.YCGGPCM....GGA.IDS....E.T....L....E---...--.............................................--G.GCSCCRQKKTQ.RK...........TVNL...V.C......P-.........-.G...K...K..Y.K...R...Y...T...Y....T....D....V.....V.....ECGCAS-s.................................................
A0A452FYC1_CAPHI/22-133                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WEivstarparppRVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A485N2Y8_LYNPA/113-223               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A212ES77_DANPL/22-125                ...........................................dvngqeiqlppg----------....---.--...--...--..--...-QECQMTPVI.......H.VLQ.....H..P...GCVP.KPIPS......Y.ACIGKCT....SYV.QVS....G.S....K....I---...WQ.............................................MER.SCNCCQESGER.EA...........SVVL...F.C......P-.........-.K...A...K..S.E...E...K...R...F....R....K....V.....StkaplECMC---rpc...............................................
A0A287ABW3_PIG/71-181                  ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2H2IAN1_CAEJA/271-384               ................................................drvldgr-------KHA....LLQ.LA...DP...DA..LN..mNQRCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGTCA....SIF.IPR....M.H....S....KKLK...-A.............................................AFR.SCAACAPAEYD.YV...........DITL...D.C......PG.........R.N...P...P..T.A...T...K...T...I....V....K....V.....K.....SCKCRE-v.................................................
B3RZY0_TRIAD/54-165                    ....................................dsinshhsygisqlpiapn----------....---.--...--...--..-Q...KAWCKLAKIE.......Q.VLS.....H..P...GCIS.KTISN......H.ICVGQCY....SYR.IPK....S.Y....P....PEAG...QE.............................................NLQ.HCECCHVVDHT.WN...........TVEL...K.C......PT.........-.L...K...N..N.V...D...K...L...V....Q....Y....I.....R.....SCDCRR-c.................................................
A0A0N4WRT2_HAEPC/5-60                  ...................................................tgae----------....---.--...--...--..--...----------.......E.IID.....E..R...GCEL.MIVRV......N.RCSGHCL....SFT.FPN....P.I....T....GKTS...--.............................................--V.HAKCCR-----.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------mtdtewvss.........................................
A0A674DZ17_SALTR/119-238               ....................................qramdksdhsktmsmslpl----------....---.-S...LK...DS..AN...RQSCAAVPFT.......Q.RIT.....S..E...GCDA.VTVHN......K.LCFGQCS....SLF.VPS....G.W....E....SARL...TGag.........................................ghRRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A674EFK1_SALTR/52-162                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...S..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A2I0UJZ1_LIMLA/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A671WK08_SPAAU/48-157                .....................................................qp--VLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.N....Y....QDGD...--.............................................VFQ.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...K...K...R...I....Q....R....V.....K.....LCR----fal...............................................
A0A5C6N4A2_9TELE/122-230               ....................................alcsaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCLP.QSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......P-.........-.D...S...P..N.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A0K0JBZ8_BRUMA/112-240               .....................lksekkgkkmisspkealhqvnqevslgrlddsr----------....---.--...--...--..-P...TAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TI...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A091MMU4_9PASS/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...D.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A091P6A4_APAVI/31-131                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEH.QSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A067QPK9_ZOONE/441-547               .....................................svtahrehkvhnivlypd----------....---.--...--...--..-K...HSWCNTTPIK.......Q.VVA.....F..P...GCNS.VEIDN......N.VCVGACF....SYS.IPR....T.A....P....SAPG...EL.............................................IKP.YCDSCQPSTVT.WH...........HVTL...N.C......TG.........E.D...P...E..S.L...Q...K...R...V....Q....I....I.....R.....NC-----..................................................
G3WY53_SARHA/138-245                   .................................................flfrks-----SASQE....VIL.PI...KS...NE..VY...QETCRTVPFS.......Q.TIL.....H..D...DCEK.VVIQN......N.LCFGKCR....SHR.LSE....A.T....T....H---...--.............................................HHA.FCSHCSPTKFT.TK...........ELLL...N.C......T-.........-.G...L...N..P.V...V...K...V...V....M....I....V.....E.....ECQCKI-k.................................................
A0A482W2Q0_9CUCU/125-251               ......................................................r-KLLKSSKN-....ALF.VT...KK...EY..LQ...RDWCKTEPLV.......Q.KVK.....E..E...GCLT.RTVIN......R.FCYGQCN....SFY.IPK....N.P....K....RRHR...HVpvteead...............................dedqngpAFK.ACAFCRPSKFT.WV...........TITL...R.C......PS.........M.T...P...P..F.R...K...K...R...I....Q....R....I.....K.....QCKCMA-a.................................................
A0A0V0UDT8_9BILA/159-280               ...........................................qqqqqqqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
G5BYV8_HETGA/75-186                    ...........................................lkhgqgvaavls----------....--L.PL...DP...QE..VA...QERCRAVPFI.......Q.VLS.....R..P...SCTA.TRVHN......H.LCFGQCS....SLY.VPG....S.A....T....A---...--.............................................SSS.LCNSCVPTRKR.WV...........PVVL...W.Cr...vgSP.........A.S...P...R..R.V...K...T...S...T....A....L....V.....E.....GCQCS--pk................................................
A0A3Q1H1V5_9TELE/57-167                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PE.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
F7AY10_CIOIN/20-103                    ..........................................lpsvtmhghrspa----------....---.--...--...--..-A...RIGCHLANFS.......R.NIR.....E..D...NCVQ.AVITI......Q.ACRGCCK....SWT.VPS....T.E....A....NKILh.pGK.............................................NIT.SKASC------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------ctilesrvirfh......................................
A0A0A0AVT2_CHAVO/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
C3XXU5_BRAFL/34-153                    ...............................veksnvadpmsewnlalhgpmear----------....---.--...--...-Q..T-...TGDCRLAGYR.......K.RIA.....M..P...WCHT.ATVLI......N.ACRGHCE....SETsLSS....D.A....T....VQAS...-Ggl.........................................hvYTT.RGSCCTIATTH.QV...........TFSM...Y.C......W-.........-.-...S...G..V.R...T...Y...T...I....E....S....A.....A.....SCACG--vc................................................
A0A3P4PKL1_GULGU/20-119                .....................................gdtdsktdssfmmdsdpl----------....---.--...--...--..--...--RCMRHHYV.......D.SIS.....H..Pl.yKCSS.KMVLL......A.RCEGHCSq..aSRS.EPL....V.S....F....STVL..kQP.............................................FRS.SCHCCRPQTSK.LK...........ALRL...R.C......SG.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------gmrltat...........................................
A0A1L8FHM0_XENLA/25-123                .................................................lalfpd----------....---.--...--...--..-K...NAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLI.HCDSCMPIDSV.WD...........VVTL...E.C......PD.........N.E...D..fP..R.V...D...K...L...V....E....K....I.....L.....QCSCQA-c.................................................
A0A091TPR0_PHALP/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A182HF90_AEDAL/1-87                  .....................................................hy----------....---.--...--...--..-T...ADDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......P-.........-.K...A...K..N.G...E...K...K...F....K....K....V.....-.....-------wnrv..............................................
W5LSW2_ASTMX/65-189                    .....................................................qd--VLSSSRE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TIS.....L..E...GCLS.RTVVN......R.FCYGQCN....SFY.IPR....H.L....T....SRSR...SRahrsqk.................................pvnhdaSFQ.SCAFCRPHRIT.TV...........TVRL...H.C......PG.........L.Q...P...P..Y.R...H...R...K...V....Q....R....V.....K.....QCRCVS-v.................................................
A0A195B087_9HYME/22-124                .............................................lygateaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P...G..E.K...K...F...R...K....M....V....T.....Ka..plDCMC---rpc...............................................
A0A4S2JC10_9HYME/96-211                .....................................sallsahrehkvhnivly----------....---.--...--...-P..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A2K5JBB4_COLAP/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
H2LKS0_ORYLA/53-184                    .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..D...GCHS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSN...QGhsrgkasgs..........................grkshnkvqePFQ.SCAFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A2I2UQD1_FELCA/17-124                ..........................................avtegwgrqvaip----------....---.--...--...--..--...--GCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnVTS.VSQCCTISGLK.KV...........KVQL...Q.C......G-.........-.G...D...R..R.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A1L8H2X4_XENLA/93-200                ................................................irrekmr------SHPD....QVL.PI...GQ...DA..LK...RSRCHALPFI.......Q.NVF.....R..K...NCFP.VRLPN......K.FCFGQCN....SFY.VPG....W.P....A....G---...--.............................................LSQ.PCTSCAPSRSR.RI...........SLPL...R.C......R-.........-.A...G...H..L.A...W...H...E...V....E....L....V.....E.....ECECET-r.................................................
A0A4X2KQP1_VOMUR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A093P6T6_PYGAD/31-131                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
G3QRB6_GORGO/56-156                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A182XZX3_ANOST/129-273               ......................................................d-KLLKSSKN-....ALL.VT...RK...EY..LK...KDWCKTEPLM.......Q.RIR.....E..E...GCMS.RTIMN......R.FCYGQCN....SFY.IPK....S.P....K....RRRH..gGKptvasysassssssn..............rrdlsgdfededltgpAFR.SCAFCKPKKFT.WM...........TVTL...R.C......PS.........L.V...P...Q..L.R...R...K...R...I....Q....R....I.....K.....QCKCIA-e.................................................
A0A2K5DKG5_AOTNA/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..IH...WETCRTVPFS.......Q.TIT.....H..E...DCEK.VVIQN......N.LCFGKCG....SAH.SPE....A.A....Q....H---...--.............................................SRA.FCSHCLPAKFT.MM...........HLPL...N.C......T-.........-.G...L...S..S.V...I...K...V...M....M....L....V.....E.....ECQCKV-k.................................................
H0XRI1_OTOGA/67-179                    ..............................................slkprqkva--------TA....MSL.PL...DP...QE..LT...QEMCKAVPFI.......Q.VVS.....R..P...GCTA.THLRN......H.LCFGRCS....SLY.IPS....S.D....A....T---...--.............................................PIV.LCNSCVPSQKR.WA...........SMAL...W.C......HA.........G.S...P...A..T.R...W...RvkiS...T....M....L....I.....E.....GCRCS--pk................................................
V3ZP56_LOTGI/34-145                    ...........................................fltisassvamd----------....---.-L...RS...GV..LN...RDKCQIQVVR.......L.TIHppeifQ..D...RCAS.ARVVS......F.GCRGQCH....SYS.KID....-.-....-....RHNT...SR.............................................IMR.SCNCCEPVRVG.IR...........LAVL...P.C......L-.........-.N...G...V..L.I...R...T...P...V....K....F....A.....R.....QCSCR--pc................................................
A0A091F550_CORBR/71-174                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....-------..................................................
A0A444U7E5_ACIRT/468-578               ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.I....K....KEQE...--.............................................SFQ.SCAFCKPQKFT.TL...........TVEL...D.C......PE.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A3S3P852_9ACAR/51-154                .......................................sqnaktrsgdgprarp----------....-MV.VA...KA...SH..MKk.kKAFCRISPLK.......Q.RIF.....D..I...GCRP.KMILN......N.YCYGQCQ....SFY.IPS....Y.T....D....DFGN...SSssgdsst..............................kkanieeaAFK.SCAFCKPHQ--.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------s.................................................
M4B0L1_XIPMA/69-179                    ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
W4Z7N0_STRPU/269-370                   ..................................vassttapasgtcgpvarqep----------....---.--...--...--..--...----------.......T.TIS.....Y..N...NCTTtEPVFM......M.ECSGKCS....SYY.GVG....K.I....V....DGVM...-T.............................................PVE.YCSCCKPSEMR.ED...........QIEL...S.C......PD.........-.-...L...S..A.L...V...I...S...V....P....V....I.....T.....ACSCHQ-v.................................................
R7TLH9_CAPTE/1-112                     ..................................................evieg------SQQ-....AFS.LT...KA...DY..LK...EEMCKTRAFK.......Q.TID.....V..P...GCES.VVLTN......H.FCYGQCN....SFF.IPR....W.V....G....KGDG..qID.............................................AFS.SVAHCRPHRGR.WV...........TIRL...R.C......PG.........Q.R...P...R..R.P...R...K...K...V....Y....V....V.....K.....SCKCM--a.................................................
A0A2K6A0R5_MANLE/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A2U3YMC2_LEPWE/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A194PN16_PAPXU/1-108                 ........................................mkektvktqevhlpp----------....---.--...--...--..--...GHECKMTPVI.......H.VLQ.....H..A...GCVP.KPIPS......Y.ACIGKCT....SYV.QVS....G.S....K....I---...WQ.............................................MER.SCNCCQESGER.EA...........TVVL...F.C......P-.........-.K...A...K..S.E...E...K...R...F....R....K....V.....TtkaplECMC---rpc...............................................
L5JS10_PTEAL/25-125                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
F7DS65_HORSE/135-244                   ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIS.....H..E...DCEK.VVVQN......N.LCFGKCA....SVH.SPG....A.A....Q....H---...--.............................................PHT.FCFHCLPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A0L7LPR3_9NEOP/10-113                ...............................................fsisqift----------....---.--...-A...ES..WR...KPGCHKIGHT.......R.NIS.....I..P...DCVE.FKIVT......N.ACRGYCE....SWS.LPS....I.M....L....GYKR...HP.............................................VTS.LGQCCNIMESE.DV...........PVKV...L.C......LD.........G.E...-...-..-.R...N...L...I...F....K....S....A.....V.....SCACY--hcq...............................................
A0A2K6JVD7_RHIBE/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A093IFB0_FULGA/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCR....SFH.VPG....P.E....G....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.G...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A1S3AC13_ERIEU/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRAT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3P8XJF4_ESOLU/51-176                .....................................................pe--VLSSSRE-....ALV.VT...ES...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....S....TSSN...RGpgsark................................knnkaeePFL.SCSFCRPHRVT.QL...........TVQL...D.C......PG.........L.Q...P...N..F.R...H...R...K...V....Q....H....V.....K.....QCRCMS-v.................................................
A0A091HYI1_CALAN/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A673CFC4_9TELE/27-142                ....................................qsassnkagdnahphlgdt----------....---.--...--...--..-D...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A0C2DBP7_9BILA/1-72                  .....................................................ml----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......Q.FCHGTCP....SYF.IPR....M.N....S....KMLK...-A.............................................RFK.SCAACAPRDYD.AV...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....V....K....V.....R.....N------ahpsrcfae.........................................
A0A3P9A1V7_ESOLU/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........S.E...D..tP..R.V...D...K...L...V....E....R....I.....I.....HCSCQS-c.................................................
A0A2U9CPM7_SCOMX/78-188                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
NBL1_HUMAN/23-123                      ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
#=GR NBL1_HUMAN/23-123           SS    ...............................................XXXXXXXX----------....---.--...--...--..-X...S-EEEEEEEE.......E.EE-.....-..T...TSB-.EEEEE......E.EEEEEEE....EEE.---....E.E....-....----...--.............................................TTE.EEEEEEEEEEE.EE...........EEEE...E.S......TT.........-.S...S..SS..E.E...E...E...E...E....E....E....E.....E.....EEEEEE-T.................................................
A0A091LSQ6_CARIC/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A5F8H5Z2_MONDO/69-179                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCKS.KTILN......R.FCYGQCN....SFY.IPR....H.V....K....KDEE...--.............................................SFQ.SCAFCKPHRVT.SV...........LVEL...E.C......PG.........L.V...P...P..F.R...H...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A437DF66_ORYJA/72-171                ................................................rlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.E...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
F7CG49_MONDO/138-245                   .................................................flfrks-----SASQE....VIL.PI...KS...NE..VH...QETCRTVPFS.......Q.TII.....H..D...DCEK.VVVQN......N.LCFGKCR....SLR.LSE....A.S....A....H---...--.............................................HHA.FCSHCSPTKFT.TK...........ELLL...N.C......T-.........-.G...P...N..P.V...V...K...V...V....M....I....V.....E.....ECQCKI-k.................................................
W5JWG9_ANODA/173-330                   ......................................................d-KLLKSSKN-....ALL.VT...RK...EY..LK...KDWCKTEPLV.......Q.RIR.....E..E...GCLS.RTIVN......R.FCYGQCN....SFY.IPK....S.P....K....RHPR...RPgghggkqnnggggggggysassssgpvsrnrevdldfededltgpAFR.SCAFCKPKKFT.WI...........TVTL...R.C......PS.........L.V...P...Q..L.R...R...K...R...I....Q....R....I.....K.....QCKCIA-e.................................................
M3Z7Z6_MUSPF/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A8E7M9_DANRE/118-229                   ................................................kkvvhks----ERKKEA....VAL.RI...NP...KD..MN...KQSCAAVPFT.......Q.RIT.....E..E...GCET.VTVHN......N.LCYGQCS....SMF.VPS....S.G....G....SHGQ...--.............................................QKA.QCTRCGPSRAR.SV...........LLHL...R.C......--.........-.G...S...E..V.R...E...R...R...V....L....I....V.....E.....ECKCET-s.................................................
A0A3Q3MJB7_9LABR/83-193                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIQ.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.N....Y....QDGD...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...Y.C......PG.........Q.T...P...S..T.R...K...K...R...I....Q....R....V.....K.....QCRCTT-i.................................................
H2UE98_TAKRU/29-140                    .....................................pskdgdngqtdpgnadpg----------....---.--...--...--..--...--RCMRHHFV.......E.TIT.....H..Pi.yKCNF.KMVLL......A.CCEGHCN....RTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.SCSCCRPHTSK.LK...........AVRL...R.C......T-.........-.G...G...R..R.I...T...A...T...Y....R....Y....I.....L.....TCNCEE-c.................................................
A0A3B1IDF9_ASTMX/107-209               .............................................hinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sA.D...T...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A3Q3H138_KRYMA/12-124                ...................................falcsaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..A...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A060X385_ONCMY/70-180                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...S..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
I3N7W2_ICTTR/14-122                    .........................................lavtegwdqeaaip----------....---.--...--...--..--...--GCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLAA...SGyr.........................................hnITS.VSQCCTISSLK.KV...........KVQL...Q.C......V-.........-.G...D...R..R.R...E...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A183J4A9_9BILA/22-109                ....................................ilamamrlvaayslskwvp----------....---.--...--...--..--...RPGCHKLAFK.......R.TIK.....I..N...GCKP.FDVHL......N.GCRGHCP....SWT.VPP....S.V....K....QADA...EQtt.........................................dnKFV.TYAT-------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------ccrmtehelv........................................
G1KC57_ANOCA/61-172                    .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
L5LLA1_MYODS/78-189                    ..............................................lqheqevat---------T....MSL.PL...DP...QE..VA...QQTCKAVPFT.......Q.VLS.....P..P...GCMA.KHLRN......H.LCFGHCS....SLY.VPG....V.D....L....A---...--.............................................PFI.LCNSCVPARRH.WT...........PVFL...W.C......R-.........V.G...S...P..V.S...R...R...R...V....KtytvL....V.....E.....RCQCS--lk................................................
A0A4U5P0D4_STECR/20-97                 .............................................vvcsvatgat----------....---.--...-A...AT..LA...KGGCKLIGHT.......H.VID.....E..L...GCDL.VAVKV......N.RCSGYCW....SFS.FPN....P.K....M....DNQL...TV.............................................HAK.CC---------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------rmletemvlq........................................
A0A2Y9DM89_TRIMA/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A0R4ICD7_DANRE/47-158                .....................................................kq-EVLASSQE-....ALV.VT...EK...KY..LK...SDWCKTQPLR.......Q.TVS.....Q..E...GCRS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KEQE...--.............................................SFQ.SCAFCRPQRFT.SL...........TVEL...D.C......PD.........L.Q...P...P..V.R...Y...R...K...I....Q....R....I.....K.....QCRCMS-v.................................................
C3XZB3_BRAFL/18-122                    ..........................................sdmgraqapwyrp----------....---.--...--...--..--...--GCHLVGVD.......K.TVE.....V..P...GCQR.QTVRV......N.ACRGYCE....SIA.FPS....S.G....T....TRQG...SSgn.........................................hvITS.RATCCDIASTH.VV...........NFSL...R.C......G-.........-.-...N...L..L.V...P...K...T...L....Y....S....A.....A.....SCSCS--ic................................................
E7F073_DANRE/29-137                    .........................................tckaesghlgdndp----------....---.--...--...--..--...-DRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL..kQP.............................................FKN.TCFCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACSCEE-c.................................................
A0A091FUZ8_9AVES/140-248               ...............................................hfmlkkns------GSEE....VVL.PI...KS...NE..MY...QENCRTLPFS.......Q.GVT.....H..E...SCER.VTVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPNKFS.MK...........YLEL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A091LH73_CATAU/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...EENCRTLPFS.......Q.GVT.....H..E...NCEK.VTVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A674EEU9_SALTR/51-158                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQWS....SRK.NHN....K.V....Q....E---...--.............................................PFQ.SCSFCRPHRFT.QL...........TVQL...D.C......PG.........L.Q...P...T..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A663DPZ0_AQUCH/40-139                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2K5L2F0_CERAT/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A158NRD9_ATTCE/18-133                .....................................sallsahrehkvhnivly----------....---.--...--...-P..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A401Q5T5_SCYTO/58-157                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVML...E.C......PG.........N.E...K..mP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A3P8SCY9_AMPPE/66-176                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIK.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.M....Y....QDGN...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
F7IPU3_CALJA/77-188                    ...............................................pqrgqdea--------AA....VTL.PL...NP...QE..VT...RGMCKAVPFV.......Q.VLS.....R..P...GCSA.TRLQN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKR.WA...........PVVL...W.C......HA.........-.G...S...S..A.S...R...R...R...VkistE....L....I.....E.....ECHCS--pk................................................
A0A091ERK4_CORBR/31-128                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.E...E..iP..R.V...D...K...L...V....E....Q....L.....L.....HCSC---..................................................
A0A3P7VJF8_HAEPC/1-94                  ..................................................mkdpr----------....---.--...--...-T..RE...TQRCESAKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.YCHGTCA....SYF.IPR....L.N....S....KKLK...-A.............................................VFK.SCAACVPRDYD.AV...........NVTL...D.C......PG.........Q.D...P...P..Q.I...T...K...S...I....V....K....V.....R.....-------k.................................................
A0A1S3S7S2_SALSA/51-176                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPH....L.M....G....PSSN...RGpgssrk................................nhnkvqePFQ.SCSFCRPHRFT.QL...........TVQL...D.C......PG.........L.Q...P...T..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A4W5MQQ3_9TELE/28-136                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A2K6NH78_RHIRO/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K6S6X1_SAIBB/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..IH...WETCRTVPFS.......Q.TIT.....H..E...DCEK.VVIQN......N.LCFGKCG....SAH.SPG....A.A....Q....H---...--.............................................SRA.FCSHCLPAKFT.MI...........HLPL...N.C......T-.........-.G...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A3P9BZ73_9CICH/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....RCSCQS-c.................................................
A0A2R8ZBR1_PANPA/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
F1PRH2_CANLF/34-134                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2K6KK89_RHIBE/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A2U9CD30_SCOMX/140-251               .......................................nkasgdnahphladsd----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A2I4AN10_9TELE/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..D...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...HGpnrgqasgs..........................grksnnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.K...Y...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A3Q7TV45_VULVU/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A0V1P6G7_9BILA/159-280               ...........................................qqqqqqqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
A0A4W6DYH2_LATCA/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A093Q8S2_9PASS/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A310SDE3_9HYME/18-132                ....................................tslhahrehkvhnivlypd----------....---.--...--...--..-K...HSWCKTTPIK.......Q.VVA.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......vN.N...P...I..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A2F0BG53_ESCRO/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPAKFT.TT...........RLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....GCQCKA-k.................................................
A0A4U1ERX5_MONMO/100-178               ..................................................dvlsr----------....---.--...--...--..--...----------.......-.---.....-..L...GCMA.VYLLN......H.LCFGHCS....SFY.IPV....H.P....L....QQLC...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------acshalgtcgplslparvgpggsgtarpgrrceqcpihaasqr.......
A0A444UU80_ACIRT/11-130                ...........................................kkaiqrdsvake----------....-GL.PV...TL...KE..AS...QTACRAVSFR.......Q.RVS.....A..P...GCLT.VTLQN......K.LCLGLCN....SLF.VPA....V.G....D....AGSA...EArpe.......................................qraLSA.SCSLCAPVKSR.TA...........LVPM...L.C......EG.........-.V...E...R..V.R...E...R...R...V....T....V....I.....E.....ECQCES-r.................................................
A0A026WU74_OOCBI/9-106                 .................................................taiigv----------....---.--...--...--..--...-DECQAMRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACKGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........-.-...A...K..P.G...E...K...K...F....R....K....VitkapL.....ECMC---rpc...............................................
A0A3Q2G7I1_CYPVA/15-124                ......................................hsaaapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A2Y9LFX4_ENHLU/78-189                .............................................qhhgqevapt----------....VSL.PL...DP...QE..VA...QEMCKAVPYT.......Q.VLS.....Q..P...GCSS.VHLRN......H.LCFGRCS....SLY.IPS....S.Q....P....T---...--.............................................PLI.LCNSCVPARKR.RT...........PVLL...W.C......RA.........S.R...P...D..S.R...R...R...MktsT....V....L....V.....E.....GCQCS--pk................................................
A0A0D8XR35_DICVI/27-103                .........................................illisshhvisiap----------....---.--...--...--..--...KYHCRKVGAE.......E.IID.....E..R...GCEL.VILRV......N.RCSGHCL....SIT.FPN....P.I....T....GRIS...--.............................................VH-.-AKCC------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------rmtdtewvisv.......................................
A0A4X2LDV6_VOMUR/50-156                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........Q.D...P...P..Y.R...H...K...K...I....Q....K....V.....-.....-------plgk..............................................
G1RR80_NOMLE/75-188                    ...........................................gslqrgqdevaa----------....VTL.PL...NP...QE..VI...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGRCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKR.WA...........PVVL...W.C.....hTG.........S.S...A...S..H.R...R...V...K...Is..tM....L....I.....E.....ECHCS--lk................................................
A0A0M3K7B7_ANISI/81-195                .....................................................kd--ALKKSQL-....AVK.IG...DA...ET..VR..rHPECEGQLFK.......Q.RIR.....M..E...GCSS.KVVIN......R.YCHGTCS....SYY.IPR....L.R....P....RKLK..lKA.............................................MFQ.SCSACRPSEYD.TI...........EVKL...D.C......PK.........K.N...P...A..H.L...I...R...R...V....V....K....V.....K.....KCSCMA-l.................................................
A0A6I8NEC2_ORNAN/24-124                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.VSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........N.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A6H5IJQ5_9HYME/8-120                 ......................................tinftvqvqaldlltvc----------....---.--...--...-S..LE...TDKCVMIPVI.......H.ILQ.....H..I...GCLP.KPVPS......F.ACIGKCS....SYV.QVR....E.L....R....F---...WR.............................................LER.SCMCCQESEIR.AL...........VVSL...Y.C......P-.........-.K...A...K..S.G...E...R...R...F....Q....K....I.....E.....T------kapvdclcrpc.......................................
A0A094KY71_PODCR/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..TH...QENCRTLPFS.......Q.GVT.....H..E...NCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCET-q.................................................
A0A673UJR4_SURSU/104-203               ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A087YS06_POEFO/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A2A3E9R4_APICC/124-232               ............................................svlicllneta----------....---.--...-K...AI..IG...VDECQATPVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........-.-...A...K..P.G...E...K...K...F....R....K....VitkapL.....ECMC---rpc...............................................
A0A671E0T7_RHIFE/127-237               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCSS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
G1N1H7_MELGA/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
U3I1Q8_ANAPP/263-373                   ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K5WJN9_MACFA/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A4W4HD89_ELEEL/54-163                ......................................................s-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.LTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TYTL...N.C......PD.........L.Q...P...P..T.K...K...K...R...V....Q....R....V.....K.....QCR----ssi...............................................
NBL1_DANRE/15-126                      ....................................elsraaphahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCTP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......SG........sD.E...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A0V1MP26_9BILA/153-291               ..........................kksrqrsnkhhhqqqqkqqqqqqrqrqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....ARLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMS-v.................................................
T1JVR8_TETUR/22-115                    ..................................................vldgs----------....---.--...--...--..--...-KGCHLRPVI.......H.VLS.....H..P...GCLS.KPIPS......F.ACHGSCS....SYV.QVS....G.S....K....F---...WQ.............................................VER.SCMCCQEMGER.EA...........TVGI...F.C......PK.........K.T...P...K..F.R...K...I...A...T....K....A....P.....V.....DCMCR--pc................................................
A0A672U319_STRHB/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A6I8SGT6_XENTR/58-157                ................................................rlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPIDSV.WD...........VVTL...E.C......PG.........N.E...E..fP..R.V...D...K...L...V....E....K....I.....L.....QCSCQA-c.................................................
E3LPN6_CAERE/240-353                   .....................................etvlegrkhallqladpd----------....---.--...--...AL..IM...NQRCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGTCA....SIF.IPR....L.H....S....KKLK...-A.............................................AFH.SCAACAPAEYD.FV...........DITL...D.C......PG.........R.T...P...P..T.A...T...K...T...I....V....K....V.....K.....SCKCKE-v.................................................
E2A3Q3_CAMFO/21-124                    ............................................llygsaeaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P...G..E.K...KfrkM...V...T....K....A....P.....L.....ECMCR--pc................................................
A0A673CQH6_9TELE/43-151                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIS.....E..E...GCLS.RTIIN......R.FCYGQCN....SFF.IPR....H.V....Y....QDGS...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...Y.C......PG.........Q.T...P...S..T.R...K...K...R...V....Q....R....V.....K.....QC-----lla...............................................
A0A5C6NQD6_9TELE/66-176                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RVIIN......R.FCYGQCN....SFY.IPR....H.T....Y....QDGG...--.............................................VFQ.SCSACKPKTFS.SV...........TYTL...L.C......PG.........Q.T...P...S..T.K...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
E2ADC3_CAMFO/61-176                    ....................................saqldahrehkvhnivlyp----------....---.--...--...--..DK...HSWCKTTPIK.......Q.VVA.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A3Q1MAY6_BOVIN/366-465               ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................ALV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A6Q0K7_STRPU/3-117                     ...................................tltttqssllmlalillslt----------....---.--...-T...SS..LV...LADCRKLGLQ.......Y.KLA.....R..P...GCRP.VTLDS......V.GCRGTCSg..yTRI.SPN....N.Y....L....E---...--.............................................VER.SCTCCQEMGFL.ER...........TQRL...Q.C......PT.........L.N...P...P..F.R...D...V...T...Y....R....I....P.....R.....RCSCR--pc................................................
A0A0L8HLI6_OCTBM/90-204                ................................................dklpikg-------SKT....AFT.VT...RK...SY..LR...KEWCKTELLK.......Q.VIR.....E..E...GCLR.QTVLN......R.FCYGQCN....SFF.IPR....S.G....K....HDGG...GA.............................................AFM.ACGYCKPRRYT.WI...........RVTL...R.C......QG........aK.H...M...R..F.K...R...R...K...V....Q....R....I.....K.....QCKCMA-q.................................................
H2SM98_TAKRU/125-241                   ..................................qmwqkavskgdlmpvslpasl----------....---.--...--...KE..G-...KQSCSGVPFT.......Q.RVT.....A..A...GCSA.VTVHN......K.LCFGQCS....SLF.VPS....E.A....P....LGTG...MGl..........................................lhHRG.PCSRCAPSKAH.AV...........VLPL...L.C......--.........-.G...A...R..V.Q...E...K...R...V....L....V....V.....E.....ECKCET-g.................................................
A0A3P8UGB9_CYNSE/29-144                ....................................agarsnsnkasdkghmhlg----------....---.--...--...--..-D...SERCMRHHFV.......E.TIT.....H..Pi.yKCNS.EMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.SCSCCRPHTSK.LK...........AIRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
GREM2_HUMAN/50-160                     ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A4D9EB53_9SAUR/54-165                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KDEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PE.........L.D...P...P..L.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3B5QUG9_XIPMA/10-119                ......................................hsaaapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCTPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A2K5C3I5_AOTNA/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A151N390_ALLMI/54-159                ........................................kvkvppetltvstpp----------....---.--...--...--..-R...PEYCTELEYE.......E.LIT.....Y..K...GCAT.-NVTL......I.RCEGMCQ....STA.KLN....A.A....T....M---...-T.............................................VHR.ECSCCVPLTQH.RK...........ELKL...P.C......PD.........-.P...D...N..P.G...K...R...L...V....M....D....I.....Ti..fgGCTCS--yd................................................
A0A060XZZ1_ONCMY/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.AIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........R.S...P...S..T.Q...K...K...R...V....Q....R....V.....K.....TCHCAS-i.................................................
H3CKP0_TETNG/125-241                   .......................................qmwqkamnkgptmavs----------....--L.PA...SL...KD..G-...RQTCSAVPFT.......Q.RVT.....A..A...GCSS.VTVHN......K.LCFGQCS....SLF.VPS....E.V....P....LGAG...TAf..........................................lhHQG.PCSRCAPSKAQ.AV...........VVPL...L.C......--.........-.G...A...R..V.Q...Q...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A340Y632_LIPVE/77-184                ............................................rmqhgqdvaxs----------....LSL.PL...DP...QE..VA...QEMCKAVPFT.......Q.VLS.....R..L...GCMA.VYLLN......H.LCFGQCS....SFY.IX-....-.-....-....----...--.............................................PFI.LCNSCVPARMR.WA...........PVVL...W.C......WA.........G.S...P...A..S.R...R...QvkmS...T....V....W....V.....E.....GCQC---gpk...............................................
A0A154NY08_DUFNO/12-115                ..............................................llsgstrai----------....---.--...--...--..VG...VDECQATPVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........-.-...A...K..P.G...E...K...K...F....R....K....VitkapL.....ECMC---rpc...............................................
A0A3Q2VWK7_HAPBU/127-241               .................................................qkvidk------GGK-....MSL.PV...NL...KD..M-...KQTCTAVPFT.......Q.HVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FEGL...SPetg.......................................afhRRA.PCSRCAPSKAQ.TV...........TVPL...R.C......--.........-.G...A...D..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A182YHP9_ANOST/10-108                ............................................aarpwsedggs----------....---.--...--...-H..YS...ADDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..N.G...E...K...K...F....R....K....-.....-.....-------trqtnn............................................
A0A3P8YTP5_ESOLU/39-149                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTI...I.C......PG.........Q.T...P...S..T.R...K...K...R...V....Q....R....V.....K.....TCHCAS-i.................................................
A0A194QN72_PAPMA/1-108                 ........................................mkekivktqevhlpp----------....---.--...--...--..--...GHECKMTPVI.......H.VLQ.....H..A...GCVP.KPIPS......Y.ACIGKCT....SYV.QVS....G.S....K....I---...WQ.............................................MER.SCNCCQESGER.EA...........TVVL...F.C......P-.........-.K...A...K..N.E...E...K...R...F....R....K....V.....TtkaplECMC---rpc...............................................
A0A2I2ZEZ2_GORGO/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2I2YQG1_GORGO/76-188                ............................................rlqrgqdevaa----------....VIL.PL...NP...QE..VI...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.IHLRN......H.LCFGRCS....SLY.IPG....A.D....P....T---...--.............................................PLV.LCNSCMPARKR.WA...........PVVL...W.C.....lTG.........S.S...A...S..R.R...R...V...K...Is..tM....L....I.....E.....GCHCS--pk................................................
A0A4W5Q5D9_9TELE/248-367               ....................................qramdksdhsktmsmslpl----------....---.-S...LK...DS..AN...RQSCAAVPFT.......Q.RIM.....S..E...GCDT.VMVHN......K.LCFGQCS....SLF.VPS....G.W....E....SARL...TDag.........................................ghRRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A093IVP7_FULGA/32-128                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HC-----gq................................................
F7GY73_CALJA/58-158                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091SNM5_PELCR/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
H0VKC4_CAVPO/133-242                   .............................................hhfmfrkgpa-------SQG....VIL.PI...KS...HE..VH...RETCRTVPFS.......Q.MIT.....H..E...GCEK.VIVQN......N.LCFGKCS....SAH.FPG....S.A....P....R---...--.............................................THS.FCSHCAPAKFT.TM...........HLQL...N.C......T-.........-.G...P...A..P.V...V...K...V...V....M....Q....V.....E.....ECQCKA-k.................................................
A0A4U5VCZ7_COLLU/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QSqnrgqasgs..........................grkshnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A2K6PM55_RHIRO/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......R.FCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--pk................................................
A0A091PDP8_APAVI/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MY...QENCRTLPFS.......Q.GVT.....H..E...NCQK.VVVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFF.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A3P9B5X7_9CICH/66-176                ..................................................yevpe------SSQE....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIE.....E..E...GCLR.RTIIN......R.FCYGQCN....SFY.IPR....N.K....Y....QDGN...--.............................................AFR.SCSACKPKAFS.TV...........TYTL...L.C......PG.........Q.T...P...S..T.K...R...K...R...V....Q....R....V.....K.....LCRCTT-i.................................................
W5M1N2_LEPOC/26-137                    ...........................................gcaaskpenrnl----------....---.--...--...SE..TD...PDRCMRHHFV.......E.TIS.....H..Py.yKCNS.KMVLL......A.RCEGHCGh..tSRS.DPL....V.S....F....SSML...KQ............................................pFRS.TCFCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.V...T...A...T...Y....R....Y....I.....L.....ACACEE-c.................................................
L5LDE5_MYODS/19-124                    ...........................................tegwgqqaaipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnVTS.ISQCCTITGLR.KV...........KVQL...Q.C......G-.........-.G...G...R..R.E...D...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A653DF41_CALMS/6-111                 ............................................rftrnskvhaa----------....---.--...--...--..SS...TDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGKCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..P.G...E...R...K...F....I....K....V.....TtkaplECMC---rpc...............................................
A0A3S1B6D3_ELYCH/171-281               ................................................nrpkrfs-------KEK....SHH.VT...S-...RS..TN...QTSCTTIMTT.......I.LVT....wG..S...TCTP.KSLII......W.YCKGFCA....TRA.VPH....Y.A....S....EQSS...DP.............................................SVE.HCECCSGRVLR.YK...........TITF...L.C......T-.........-.-...D...G..N.R...N...R...T...V....A....W....P.....F.....ECACR--pc................................................
A0A452EMV2_CAPHI/14-124                .......................................lllavtegqsqqaaip----------....---.--...--...--..--...--GCYLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLR.KV...........KVQL...R.C......G-.........-.G...S...R..K.E...E...L...E...V....F....T....A.....R.....ACQCDM-c.................................................
H3C4U3_TETNG/32-132                    ...............................................nrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCLP.QSVQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PD........sE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A091JZQ4_EGRGA/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A4W4FDK7_ELEEL/48-158                ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LR...SDWCKTQSLR.......Q.TVS.....Q..E...GCHS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KDQE...--.............................................SFQ.SCAFCKPHRWT.TL...........TVQL...D.C......PD.........L.Q...P...A..F.R...Y...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
E2QVG1_CANLF/53-163                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A340XJV6_LIPVE/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
H0Z2F5_TAEGU/143-251                   ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFA.......Q.GVT.....H..N...SCEK.VTVQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYT.FCSRCLPSKFS.MK...........RLDL...N.C......T-.........-.D...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCES-r.................................................
A0A4D9F8E0_9SAUR/1-88                  ......................................................m----------....---.--...--...--..-Y...QETCRTLPFS.......Q.SIV.....H..E...NCEK.VVVQN......N.LCFGKCS....SFH.IPG....P.E....D....R---...--.............................................LYT.FCSHCLPTKFT.MK...........RLEL...N.C......T-.........-.R...S...V..A.V...V...K...V...V....M....I....V.....E.....DCKCEI-q.................................................
H3DJ93_TETNG/59-169                    ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
G3HCA3_CRIGR/135-244                   .............................................hrfmfrkgpa-------SQG....VIL.PI...KS...HE..VH...RETCRTVPFN.......Q.TIA.....H..E...DCEK.AVIPN......N.LCFGKCG....SIH.FPG....A.E....P....H---...--.............................................PYN.FCSHCSPTKFT.TM...........SLRL...N.C......T-.........-.S...P...T..P.V...V...K...M...V....M....Q....V.....E.....ECQCMT-k.................................................
A0A087QJS5_APTFO/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A2I3N3V5_PAPAN/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091S1R3_NESNO/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A093PXX0_9PASS/142-250               ................................................hfilkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFA.......Q.GVT.....H..N...SCEK.VTVQN......N.LCFGKCS....SFH.VPG....P.E....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLNL...N.C......T-.........-.G...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCKT-r.................................................
A0A498M7V5_LABRO/64-174                ......................................................d-EVLDSSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......L.MIY.....E..D...GCQP.RAIIN......R.FCYGQCN....SFY.IPR....H.V....Y....QEDN...--.............................................AFQ.SCSVCKPKSFT.TV...........TYTL...N.C......PG.........Q.T...P...S..T.K...K...K...R...V....R....R....V.....K.....QCRCTS-v.................................................
A0A091NU69_HALAL/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A4U5UB98_COLLU/82-186                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A341CR14_NEOAA/110-219               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPGKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....ECQCKV-k.................................................
A0A2I3RWS4_PANTR/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
W4YVX7_STRPU/61-176                    ................................qsdssdthygahlidrtvlfphd----------....---.--...--...--..--...TTWCVARPIS.......Q.VIE.....S..P...GCTA.RTIPN......K.MCAGQCY....SFT.VPK....I.F....P....HDIR...-S.............................................QFK.SCDCCQPSRVT.WV...........TIPL...S.C......NA........vD.G...D...T..V.L...H...K...H...V....E....V....V.....E.....ECECK--pc................................................
A0A087VNN2_BALRE/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A5J5DNT1_9PERO/130-244               ...................................................qrai----NKGEK-....MSL.PV...NL...KD..T-...KQTCTAVPFT.......Q.RVT.....A..D...GCST.VTVHN......K.LCFGQCS....SLF.VPS....E.G....D....FAGL...GTgtg.......................................alhHRT.PCSRCAPSKAR.TV...........AVPL...H.C......--.........-.G...A...K..V.W...E...K...Q...V....M....V....V.....E.....ECKCET-g.................................................
W5N2Q5_LEPOC/57-173                    ......................................................n-NTMNRAKHGg.rtLSA.NT...HS...YG..AS...ELSCRELRST.......R.YIT.....D..G...PCRSaKPVKE......L.VCSGQCV...pSHL.LPN....S.I....L....RGKW...WR.............................................HSH.SDYRCVPAHSR.TQ...........RVQL...Q.C......P-.........-.N...G...R..S.R...T...Y...K...I....R....V....V.....T.....SCKCKR-y.................................................
A0A498LBD8_LABRO/59-169                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.R...K...K...R...V....Q....R....V.....K.....QCRCIS-i.................................................
A0A1W4WHP9_AGRPL/33-145                ....................................kqchserehkvhnivlypd----------....---.--...--...--..-R...HSWCQTTAIK.......Q.IVA.....S..P...GYEP.VTIDN......N.VCVGACY....SYS.IPR....T.Q....P....AEPG...EL.............................................IGP.YCDSCKPADSR.CY...........HVTL...H.D......DK.........N.S...S...K..T.I...Q...K...R...V....Q....I....I.....T.....NCSCSS-c.................................................
W5N4F1_LEPOC/73-183                    ......................................................e-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..D...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................AFQ.SCSFCKPFRFT.KM...........TFTL...N.C......PE.........Q.Q...P...S..T.K...K...K...R...V....Q....R....V.....K.....ECRCVS-i.................................................
A0A6A5FLA7_PERFL/59-163                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.E...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A4D9ETL9_9SAUR/42-141                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.A...E..iP..R.V...D...K...L...V....E....K....I.....L.....RCSCQA-c.................................................
A0A2Y9DK17_TRIMA/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2I4B246_9TELE/19-130                ...................................falcsaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSVQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........S.E...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
S9Y9A5_CAMFR/49-92                     ......................................................r-EVLSSSQE-....ALV.VT...ER...RY..LR...RDWCKTQRLR.......Q.TAS.....S..S...----.-----......-.-------....---.---....-.-....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------qpsslrsl..........................................
A0A3Q3WQV3_MOLML/60-170                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIQ.....E..E...GCLS.RVIIN......R.FCYGQCN....SFY.IPR....H.T....Y....QDGG...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
A0A210R5R2_MIZYE/15-117                ............................................vylvllltvvn----------....---.--...--...--..--...-CQCNRGRIR.......H.TLT.....Y..H...NCQP.KRLLS......W.GCAGTCQ....AYS.RPS....S.T....V....PGD-...--.............................................IEH.FCECCKHTEFE.TR...........RTIL...Q.C......PS.........T.D...G...L..S.F...R...RiavR...V....N....I....P.....S.....GCACR--pc................................................
A0A4W5QJ12_9TELE/227-339               .............................pkscitklinviqdqsvifgstasgi----------....---.--...--...--..--...-------CVM.......E.RIM.....S..E...GCDT.VMVHN......K.LCFGQCS....SLF.VPS....G.W....E....SARL...TDag.........................................ghRRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A3Q1CSU0_AMPOC/52-182                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSHG...QSrghgsgsg............................rknhnkvqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A674CSK5_SALTR/365-484               .....................................qramdkshhsktmsmslp----------....---.LS...LK...DS..AN...RQSCAAVPFT.......Q.RIT.....S..E...GCDA.VTVHN......K.LCFGQCS....SLF.VPS....G.W....E....SARL...TGtg.........................................ghRRA.PCSRCAPSKTH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A553MRZ6_9TELE/68-178                ......................................................e-EVLDSSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......L.MIY.....E..D...GCQP.RAIIN......R.FCYGQCN....SFY.IPR....H.V....Y....QEDG...--.............................................AFQ.SCSICKPKSFT.TV...........TYTL...F.C......PG.........Q.T...P...N..T.K...K...K...R...V....R....R....V.....K.....QCRCTS-v.................................................
A0A3Q3WND1_MOLML/53-185                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QGqnrgqasgs..........................grkthnkaqePFQ.SCSFCKPYRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A2K6RTQ9_RHIRO/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A286XYF5_CAVPO/53-170                ......................................................n-KTMNRAENGg.rpPHH.PF...KA...TD..AS...EFSCRELRST.......R.FVT.....E..G...PCRSaKPVTE......L.VCSGQCG...pARL.LPN....T.I....G....RGKW...WR............................................lGVP.APPRCVPDRHR.AQ...........HVQL...L.C......P-.........-.G...A...A..P.R...A...R...K...V....R....L....V.....A.....SCKCKW-l.................................................
F6UA84_ORNAN/56-166                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRLA.SV...........LVEL...D.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCIS-v.................................................
A0A5N3XS81_MUNRE/15-124                ..........................................llaategqnrqat----------....---.--...--...--..--...IPGCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLR.KV...........KVQL...H.C......G-.........-.G...D...R..K.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
G3P6X1_GASAC/52-167                    ...................................................kpav---LSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PNSDk.aQE.............................................PFQ.SCSFCRPHRVT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A6I8UN53_DROPS/28-141                .....................................klctaqadnavappendi----------....---.--...--...--..TH..lGDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A443QL31_9ACAR/1-87                  ......................................................m----------....---.--...--...--..--...----------.......-.---.....-..-...----.--ILN......N.YCYGQCQ....SFY.IPS....Y.T....D....DFGN...SSssgdsst..............................kkanieeaAFK.SCAFCKPHQSV.YV...........SIRL...I.C......PS.........R.S...P...P..F.K...Q...K...R...V....Q....K....I.....K.....KCRCTT-e.................................................
A0A2K6S799_SAIBB/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A226PQP6_COLVI/1844-1928             ................................................yqydsgs----------....---.--...--...--..--...--------AS.......Q.SVA.....H..E...SCDK.VIVQN......N.LCFGKCS....SFH.VPG....R.D....D....H---...--.............................................LYT.FCSKCLPTKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECNCET-q.................................................
A0A340XQU2_LIPVE/25-140                ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A091VE11_NIPNI/71-179                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....-....-.....L.....ECRCIS-i.................................................
A0A2G5TGR8_9PELO/242-355               ..................................................dtvle-----GRKHA....LLQ.LA...DP...DA..LR..mNQRCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGTCA....SIF.IPR....H.S....T....KKLK...-A.............................................AFR.SCAACAPSEYD.YV...........DITL...D.C......PG.........K.S...P...P..T.T...T...K...T...I....V....K....V.....K.....SCKCRE-v.................................................
A0A287A2H0_PIG/127-237                 ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A091P2N7_APAVI/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A091PMF7_HALAL/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.VVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..V.V...V...K...E...V....M....I....V.....E.....ECKCET-p.................................................
A0A091LY13_CATAU/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A1U7SDG3_ALLSI/145-252               .................................................ftlqkn-----SASEE....VVL.PI...KT...DE..MH...QETCWTLPFS.......Q.GIV.....H..E...NCEK.AVVQN......N.LCFGKCN....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPAKFN.LK...........RLEL...N.C......T-.........-.K...S...V..P.I...V...K...V...V....V....I....V.....E.....ECKCEI-q.................................................
M3W3X3_FELCA/69-179                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
H3B6P7_LATCH/124-233                   .............................................ramemgsgkv--------KE....MVL.PL...SQ...TE..AS...RSSCKAIPFI.......Q.NIS.....E..P...KCET.ITIQN......R.FCFGQCS....SFY.IPD....S.S....E....RR--...--.............................................LLH.SCSRCAPSKVR.KT...........IVSL...K.C......H-.........-.N...G...I..I.A...D...R...E...A....T....H....I.....E.....ECECEA-q.................................................
W5LUB0_ASTMX/48-148                    ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....Q..E...GCRS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEQE...--.............................................SFQ.SCAFCRPHRFT.TL...........TVEL...D.C......PT.........C.S...-...-..-.-...-...-...-...-....-....-....-.....-.....-------rrsgtgrss.........................................
A0A2U3WJV0_ODORO/1-111                 ..............................................msrtaytvg----------....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3M6UQP3_9CNID/30-140                ....................................................edg---LKSQDEH....DVF.IM...KK...SE..LK...NGWCKTLPFK.......Q.TIK.....V..D...GCLP.VTVKN......N.YCYGQCN....SLY.IPS....H.E....S....P---...LP.............................................LFN.TCASCLPQRTF.TK...........TVTL...R.C......PS.........L.S...V...K..F.R...K...H...K...Y....T....Y....S.....K.....RCRCSS-v.................................................
H2UGZ2_TAKRU/69-179                    ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
E5RFZ1_HUMAN/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091IXB8_EGRGA/71-167                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...-...-...-...-....-....-....-.....-.....-------k.................................................
A0A669C3C3_ORENI/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....RCSCQS-c.................................................
H2N3A5_PONAB/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K6WA20_ONCVO/119-240               ..............................kkvvsspkealqqvnqevslgrldd----------....---.--...--...-S..RP...AAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPTEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A2K6K068_RHIBE/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
H2PS54_PONAB/135-215                   ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....Q....H---...--.............................................SHT.FCSHCLPAKFT.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------..................................................
L8Y9F9_TUPCH/135-244                   ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFR.......Q.TVT.....H..E...DCEE.VVVQN......N.LCFGKCG....SIP.FPG....A.A....Q....H---...--.............................................PQA.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.S...S...A..S.V...V...K...V...V....M....L....V.....E.....ECQCKV-e.................................................
A0A4U1ELB5_MONMO/239-349               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A091GUL7_BUCRH/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
F7DJA6_MACMU/135-244                   ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A673T6T5_SURSU/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTLLN......R.FCYGQCN....SFY.IPR....H.V....R....QEEA...--.............................................SFQ.SCAFCKPQRVT.SA...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A6A1QFU2_BALPH/36-119                ............................................pdkaqhndseq----------....---.--...--...--..--...----------.......-.---.....-..-...--TH.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A5C6P2A9_9TELE/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
W5NLG3_LEPOC/47-158                    .....................................................kq-EVLASSQE-....ALV.VT...EK...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....K....KEQE...--.............................................SFQ.SCAFCKPQKFT.TL...........TVEL...D.C......PG.........L.Q...P...T..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A3Q1J119_ANATE/27-142                ...................................qstnsnkasdighphlgesd----------....---.--...--...--..--...PQRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A091QVM1_MERNU/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q7U6H0_URSAR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A016UEQ8_9BILA/111-221               ................................................kplldgr-------NQA....LIT.IK...DT...RE..M-...-QRCEGSKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.FCHGTCP....SYF.IPR....M.N....S....KILK...-A.............................................KFK.SCAACAPRDYD.AV...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....V....K....I.....K.....KCECI--dl................................................
A0A0R3PG09_ANGCS/145-251               ...............................................kplidgrn---------H....ALI.TL...ND...PH..MR..pVQRCEGAKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.FCHGICS....SYF.IPR....I.N....S....KKLK...-A.............................................VFK.SCAACAPKEYD.RF...........DVTL...D.C......PG.........Q.N...P...P..Q.V...T...K...S...I....I....-....-.....-.....-------klpa..............................................
K1QSB9_CRAGI/2-87                      .....................................................gh----------....---.--...--...--..--...---------T.......R.TVQ.....I..P...GCLE.FNVTT......N.ACRGFCE....SYA.IPS....S.Q....R....TLSA..nTRh...........................................iLTS.RAECCGIEETH.DI...........TVSV...G.C......A-.........-.-...D...G..L.R...E...V...T...F....K....S....A.....K.....TCACSV-c.................................................
A0A5E4PRR9_9NEOP/185-302               ......................................................r-NILKSSKN-....ALV.VT...KK...EY..LK...EDWCKTEQLV.......Q.KIR.....E..P...GCLQ.ATVLN......N.FCYGQCN....SFY.IPK....N.P....R....RREG...NDer........................................pppAFK.SCSFCKPKKFT.WI...........TVTL...R.C......PG.........Q.N...P...P..F.K...R...K...R...L....Q....K....I.....K.....QCKCL--pv................................................
A0A4W5RC07_9TELE/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........S.E...D..tP..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A2I0MG52_COLLI/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GIT.....H..E...TCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCEI-q.................................................
A0A4X2K141_VOMUR/126-225               ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCKS.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPSQSM.WE...........IVTL...D.C......PS.........H.D...E..mP..R.V...D...K...L...V....E....K....I.....I.....HCSCQA-c.................................................
A0A1Y3ANS8_EURMA/22-127                .............................................vlmarccsss----------....---.--...--...-V..WE...QKGCHIVGHT.......Q.KID.....I..P...GCIN.FELTS......N.ACRGYCV....SYA.IPS....N.Q....E....TLSV...NEk..........................................qmITS.VGNCCAMTETE.VM...........NVRV...M.C......R-.........-.-...N...G..P.K...D...I...K...F....K....S....A.....A.....KCGCF--hc................................................
A0A2B4S149_STYPI/202-305               ........................................hkvplstggpqvnlg----------....---.--...-R...LN..LK...SDWCVTHPFN.......E.TVH.....H..R...GCQS.AQINN......S.MWYGQCN....SFF.IPK....K.-....-....----...--.............................................-FV.SCSYCAPFKQE.TI...........NVRL...E.C......PG.........Q.N...P...S..F.V...I...K...K...V....K....V....V.....K.....ECACH--dc................................................
A0A3B1JEM7_ASTMX/58-168                ....................................................eep---LDSSQE-....ALH.VT...ER...HY..LK...RDWCKTQPLK.......Q.ALR.....E..E...GCLT.RYIIN......S.FCYGQCN....SFY.IPR....H.L....H....QGDG...--.............................................AFQ.SCSFCKPKSFT.AV...........SYTL...Q.C......PG.........Q.I...P...R..L.R...R...K...R...V....L....R....V.....K.....QCRCTS-i.................................................
A0A2P4T7B3_BAMTH/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A226ESI8_FOLCA/325-430               ........................................ddeldtssnltpnss----------....---.-G...ES...NK..KK...RSCCRTQKYS.......Q.VIK.....R..D...GCEP.LTVMN......K.MCFGQCV....SVW.VPG....L.F....S....----...--.............................................---.SFPVCKPSRSS.WK...........TVIL...T.C......GK.........N.R...D...R..K.K...R...V...R...I....E....K....V.....R.....RCSCME-i.................................................
A0A484CS71_PERFV/69-181                .....................................ssnmasdnghphlgdsdp----------....---.--...--...--..--...-QRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HIT.RSD....P.L....I....SFSSv.lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A0C2CWH2_9BILA/27-113                ..........................................llvsshhtiaygv----------....---.--...--...--..--...KYHCRKVGAE.......E.IID.....E..R...GCEL.MILRV......N.RCSGHCL....SFT.FPN....P.I....T....GKTS...--.............................................--V.HAKCCRMT---.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------dtewvglssflyncvictv...............................
A0A2T7NZC2_POMCA/57-172                ............................................thsktpikshs----------....NQA.IT...AQ...LF..FK...KEKCRTSPMT.......Q.VVH.....E..K...GCLR.KKIAN......N.FCSGQCN....SVF.IPM....S.A....R....QDKT...VD.............................................AFM.PCGFCRPRQLD.WI...........VVKL...R.C......PT........kH.G...M...R..Y.R...Q...K...H...V....Q....Y....V.....K.....DCRCMT-l.................................................
A0A195EXF7_9HYME/77-191                .....................................allsahrehkvhnivlyp----------....---.--...--...--..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
I3KYY6_ORENI/69-179                    ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A0V1NMT1_9BILA/19-121                ...................................ssssklswtksaggdssnnl----------....---.--...--...-S..LF...QQDCRIVAVE.......K.LIT.....I..P...GCIP.VRVQL......N.ACRGYCL....SWT.VPD....G.R....R....TVA-...--.............................................SYA.MCC--------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------rmverelstkkllvnkrvpvgdsqrdvvr.....................
A0A3Q4GMT2_NEOBR/19-122                ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....RCSCQS-c.................................................
A0A084VXY8_ANOSI/10-118                ................................................ifcaiml----------....---.AR...AR...ET..WQ...KPGCHKVGHT.......R.KIS.....I..P...DCVE.FTITT......N.ACRGFCE....SFA.VPS....A.P....F....AIVG...HKpp.........................................qpVTS.VGQCCNIMETE.DV...........RVRV...L.C......V-.........-.-...N...G..I.R...N...L...T...F....K....S....A.....T.....NCSCY--hc................................................
A0A6A4VMI9_AMPAM/14-110                .........................................vaaltvaasrlalt----------....---.--...--...--..-G...ADECKLTPVV.......H.VLQ.....Y..P...GCVP.KPIPS......Y.ACVGHCT....SYV.QVS....G.S....K....L---...WQ.............................................TER.SCMCCQESGQR.EA...........SVSI...F.C......PK.........A.K...Q...S..-.-...D...-...-...-....-....-....-.....-.....-------qkfrkals..........................................
A0A093D296_TAUER/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A4X2L2Z4_VOMUR/87-199                .............................................rpqeeeempa----------....VSL.PL...SP...KD..VV...RETCKAVPFT.......Q.VVS.....R..P...GCTS.VRLQN......K.FCFGRCS....SFY.IPS....A.G....L....T---...--.............................................RRH.LCNSCLPSRHR.RV...........PVVL...W.C......QA.........V.G...K...P..T.S...R...R...R...L....K....VstslV.....E.....ACQCHT-h.................................................
A0A3P9D0H9_9CICH/28-143                .....................................sasssnkasdnghahlgd----------....---.--...--...--..AD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......T-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A2K5RM82_CEBCA/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
C6SUQ1_CIOSA/9-115                     ..............................................lfcainlvv----------....---.--...-A...RH..HR...RTGCHLETYT.......K.HIR.....I..P...GCVY.AEINI......T.ACNGCCR....SYS.IPS....S.V....R....TKAAf.pGR............................................nITS.RSSCCTILNTE.VI...........HFHL...L.C......--.........-.G...T...R..M.V...P...H...W...I....H....S....A.....T.....SCDCG--ac................................................
A0A1S3HEG2_LINUN/26-132                .......................................gqdahpplqsivfhse----------....---.--...--...--..-S...HTWCESRPIQ.......Q.ILT.....Q..P...GCES.QSVEN......K.VCVGQCY....SYS.VPN....T.L....P....SQNA...-G.............................................LLQ.RHDVCKPARAR.WE...........KVTL...Q.C......A-.........-.N...G...H..M.L...P...K...F...V....Q....I....I.....E.....ECACAS-c.................................................
D6X356_TRICA/9-119                     .............................................tllslsdafm----------....VKA.VT...AR...DA..WQ...KPGCHKVGHT.......R.KIS.....I..P...ECVE.FHMTT......N.ACRGFCE....SWA.VPS....G.P....K....ATPT...QP.............................................VTS.VGQCCNIMETE.PV...........EARV...L.C......V-.........-.-...D...G..V.R...T...L...T...F....K....S....A.....V.....SCSCY--hc................................................
G3UFT9_LOXAF/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....QCSCQA-c.................................................
A0A3Q3W9I1_MOLML/128-250               .........................................mwqrainkggmmav----------....-SL.PV...NL...KE..T-...RQTCTAVPFT.......Q.RVT.....A..V...GCDT.VTVHN......K.LCFGQCS....SLF.VPS....E.M....E....FAGL...GAgtgal...................................hhhrqYRT.PCSRCAPSKAH.TV...........VVPL...H.C......--.........-.G...L...Q..L.R...E...K...R...V....M....V....V.....E.....ECKCET-s.................................................
A0A1L8HP10_XENLA/211-318               ................................................nflvkmn-----GAPQN....TSH.GS...KA...QE..IM...KEACKTLPFT.......Q.NIV.....H..E...NCDR.MVIQN......N.LCFGKCI....SLH.VPN....Q.Q....D....RR--...--.............................................--N.TCSHCLPSKFT.LN...........HLTL...N.C......T-.........-.G...S...K..N.V...V...K...V...V....M....M....V.....E.....ECTCEA-h.................................................
G3Q764_GASAC/129-246                   ............................................qravgkgdkms----------....VSL.PI...DL...RD..T-...KQACTAVPFT......qQ.RVT.....A..D...GCDA.VTVHN......K.LCFGQCS....SMF.VPP....E.G....E....LARP...GAgtg.......................................alrHRA.PCSRCAPSKAQ.TM...........TVPL...R.C......--.........-.G...A...T..V.Q...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A087WTY6_HUMAN/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A3KFI4_HUMAN/23-117                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E...V..P.R..vD...K...L...V....E....-....-.....-.....-------kilh..............................................
A0A1L8GJK7_XENLA/4-120                 .............................................vsasvllvla----------....-VM.VQ...ES...FG..IA...RPGCHLHPFN.......V.TISs..drK..G...TCRG.TQVIN......-.ACVGYCE....SSA.FPS....K.Y....S....VLVA...SGfk.........................................hnITS.ASQCCTISKMQ.KV...........KVQL...H.C......G-.........-.G...S...H..Q.E...E...I...E...I....G....T....A.....L.....SCQCD--mc................................................
B4K981_DROMO/27-140                    ....................................klcmaqsegtatatdndig----------....---.--...--...--..HL...GDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK........vK.H...G...E..R.K...F...K...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A3Q4GWE2_NEOBR/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....RCSCQS-c.................................................
A0A5E4A2T8_MARMO/14-122                .........................................lavtegwdqeaaip----------....---.--...--...--..--...--GCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLAA...SGyr.........................................hnITS.VSQCCTISSLK.KV...........KVQL...Q.C......V-.........-.G...D...R..R.R...E...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A3Q1DC16_AMPOC/66-176                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIK.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.M....Y....QDGN...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
A0A4X2K6G4_VOMUR/24-123                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCKS.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPSQSM.WE...........IVTL...D.C......PS.........H.D...E..mP..R.V...D...K...L...V....E....K....I.....I.....HCSCQA-c.................................................
A0A3S4RHW9_9ACAR/165-274               ...........................................lkmftaflilmf----------....---.VC...GH...SY..GN...KEICHLRPVI.......H.LLK.....H..P...GCMP.KPIPS......F.ACQGSCS....SYV.QVS....G.S....K....F---...WQ.............................................VER.SCMCCQEMGER.EA...........TVSV...F.C......PQ.........A.V...P...K..F.R...K...I...V...T....R....A....P.....V.....NCMCR--pc................................................
A0A0V0TIS7_9BILA/11-111                ..........................................tksaggdssnnls----------....---.--...--...--..LF...QQDCRIVAVE.......K.LIT.....I..P...GCIP.VRVQL......N.ACRGYCL....SWT.VPD....G.R....R....TV--...--.............................................-AS.YAMCCRMVERE.LV...........EFET...R.C......Q-.........-.E...S...K..R.E...K...F...S...F....T....S....A.....V.....TCEC---fds...............................................
A0A384D167_URSMA/25-140                ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A671U4D2_SPAAU/130-236               ....................................................qra---MSKGEK-....MSL.PV...NL...KD..T-...KQTCAAVPFT.......Q.RVT.....A..D...GCDT.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FAGV...--.............................................HRS.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...A...E..V.R...D...R...R...V....M....V....V.....E.....ECKCET-s.................................................
A0A3N0YYE6_ANAGA/60-170                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.R...K...K...R...V....Q....R....V.....K.....QCRCIS-i.................................................
A0A0L7K2C7_9NEOP/1-88                  .....................................................ma----------....---.--...--...--..--...-------PVI.......H.VLT.....H..S...GCKP.KAIPS......F.ACIGKCS....SYV.QVS....G.S....K....I---...WQ.............................................MER.TCNCCQESGER.EA...........SVVL...Y.C......PD.........-.-...A...K..S.E...E...K...R...F....R....K....V.....StkaplECMC---rpc...............................................
A0A383ZAK0_BALAS/78-184                ............................................lqhgqdvaxsl----------....-SL.PL...DP...QE..VA...QEMCKAVPFT.......Q.VLS.....R..L...GFMA.VHLLN......H.LCFGHCS....SFY.IXP....-.-....-....----...--.............................................-LI.LCNSCVPTRTR.WA...........PVFL...W.C......WA.........G.S...P...A..S.RrqvK...M...S...T....V....R....V.....E.....GCQCR--pk................................................
A0A2K5KQH2_CERAT/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A6A1QCV0_BALPH/59-140                ..............................................smgrmwpsl----------....-SL.PL...DP...QE..VA...QEMCKAVPFT.......Q.VLS.....R..L...GFMA.GHLLN......H.LCFGHCS....SSY.IPA....H.P....L....QQL-...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------cvrshalgtcgslvlggq................................
A0A091RVN8_MERNU/31-108                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVSI...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------pgp...............................................
A0A2R9CG90_PANPA/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
H3AU53_LATCH/17-131                    .............................................vamgrasgnm----------....--D.IT...NI...VD..MD...PARCMRHHYV.......D.TIS.....H..Pl.yKCSS.KMVLL......A.RCEGRCS....QTC.RSD....P.L....I....SFSTi.lKQ............................................pFKS.TCHCCKPKASK.LK...........AVRL...R.C......G-.........-.S...G...M..R.L...T...A...T...Y....R....Y....I.....L.....SCSCER-c.................................................
A0A016TQ13_9BILA/25-125                ........................................mlllvsshhtiaygv----------....---.--...--...--..--...KYHCRKVGAE.......E.IID.....E..R...GCEL.MILRV......N.RCSGHCL....SFT.FPN....P.I....T....GKTS...--.............................................--V.HAKCCRMTDTE.WV...........NTEL...S.C......E-.........-.-...D...G..P.R...P...I...K...I....P....S....A.....V.....QCDCF--dc................................................
T1HWY4_RHOPR/61-174                    .....................................................kk--LLKAQQG-....GQL.VT...RR...EH..LK...KDWCKAEPLV.......H.KIR.....D..A...GCIP.NTVVN......R.FCYGQCN....SFY.IPG....R.S....G....RRRR..sEV.............................................DFR.SCAACRPSLAN.WI...........TVNL...S.C......PG.........G.N...P...P..H.K...T...R...R...V....Y....R....V.....K.....RCKCVA-h.................................................
U3HYK2_ANAPP/71-181                    ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
G1R8Q8_NOMLE/58-158                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3Q2DRY8_CYPVA/133-247               ....................................................qrv---MNKGGK-....VSL.PV...NL...KD..P-...KQTCTAVPFT.......Q.HVT.....A..D...GCQT.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FADL...SPgtg.......................................afrRRA.PCSRCAPFKAQ.TV...........TVPL...R.C......--.........-.G...A...K..V.R...E...K...R...V....L....L....V.....E.....ECKCET-g.................................................
H2NCY3_PONAB/16-124                    ........................................lavteawgqeavipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLK.KV...........KVQL...Q.C......V-.........-.G...S...R..R.E...E...I...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A091MUY4_9PASS/71-166                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..-.-...-...-...-...-....-....-....-.....-.....-------rk................................................
A0A3P4PKR3_GULGU/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2K6EM56_PROCO/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3P9AP61_ESOLU/141-260               .....................................qrameksdqrktlsmslp----------....---.LS...LK...DS..AN...QQTCTAVPFT.......Q.RIT.....S..E...GCDT.VTVHN......K.LCFGQCS....SLF.IPS....G.G....E....SASQ...SGte.........................................ghPVA.PCSRCSPSKAH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...V...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A2U3VPP0_ODORO/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2I4AXU3_9TELE/127-237               ...............................................qkvvdkge--------K-....ISL.PV...SL...KD..S-...KQTCTAVPFT.......Q.HVT.....A..D...GCQT.AALHN......R.LCFGQCS....SLF.VPS....G.G....E....FVETg.aFH.............................................LRA.PCSRCAPSRAR.TV...........PVLL...R.C......--.........-.G...A...Q..V.R...E...K...R...V....M....V....V.....E.....ACKCET-n.................................................
A0A091SAT7_NESNO/71-169                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...-....-....-....-.....-.....-------..................................................
A0A1V4KFI5_PATFA/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A383ZGX9_BALAS/15-124                .......................................vlavtegqgqqaaipg----------....---.--...--...--..--...---CYLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISSLR.KV...........KVQL...H.C......G-.........-.G...D...R..R.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A4W6ESD5_LATCA/20-118                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------ifhcscqscskegaqegav...............................
A0A1S2ZMP6_ERIEU/70-180                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3Q7SKV5_VULVU/132-241               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...F...A..P.V...V...K...V...V....M....L....V.....K.....ECQCKM-k.................................................
A0A2K6K046_RHIBE/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A093CYK5_TAUER/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
F6XPS4_HORSE/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...D.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K5J2N7_COLAP/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A674HD84_TAEGU/40-139                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.E...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A087V3N8_BALRE/31-130                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
DAND5_XENTR/94-200                     .................................................rrekmr------SHPD....QVL.PI...GQ...DA..LK...RSRCHALPFI.......Q.NVF.....R..K...NCFP.VRLPN......K.FCFGQCN....SFY.VPG....W.P....A....G---...--.............................................LSQ.PCTSCAPSRSR.RI...........SLPL...R.C......R-.........-.A...G...H..L.A...W...Q...E...V....E....L....V.....E.....ECECET-r.................................................
A0A4W4GTM7_ELEEL/60-187                .....................................................re--LLSSSRE-....TLV.VS...ER...KY..LR...SDWCRTQPLQ.......Q.TLS.....L..E...GCVS.RTVFN......R.FCYGQCN....SFY.IPR....Q.L....T....SHPQ...TPprqgrkp..............................tsgpkhdaPFQ.SCGFCRPHRIT.TV...........IVRL...H.C......PG.........L.R...P...P..Y.R...H...R...K...V....Q....R....I.....K.....QCRCVA-v.................................................
A0A6A4XAC3_AMPAM/50-163                ..................................llaqeeaegehdrnaptpaqf----------....---.--...--...--..--...QSRCELVGHT.......Q.LVQ.....V..R...GCAP.VELTV......N.ACDGMCG....SSA.HPS....S.W....H....TLSM...NPr..........................................haVTS.VGQCCNIMETK.NV...........SIKM...E.C......I-.........-.-...D...G..P.K...Y...V...K...I....K....S....A.....K.....SCACF--hc................................................
V8NA61_OPHHA/47-153                    .........................................sapspinklalfpd----------....---.--...--...--..-K...NAWCEAKNIT.......Q.IIG.....Q..T...GCNS.KSIQN......R.ACMGQCF....SYS.VPN....T.L....P....QSTE...--.............................................SLV.HCDSCMPLNIQ.WE...........IVSL...D.C......PN........yE.F...G...P..R.V...E...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A5N5N342_PANHP/64-189                ....................................................kqe--VLLSSRE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....L..E...GCVS.QTIIN......H.FCYGQCN....SFY.IPR....H.L....A....PANG...RHgrkrtp.................................ksnygaSFQ.SCAFCKPHRIS.TL...........TVRL...H.C......PR.........L.Q...P...P..Y.R...H...R...K...V....Q....R....I.....K.....ECRCMS-v.................................................
A0A0D8Y415_DICVI/152-266               ...........................................rrkplidgrnqa----------....LIT.LN...DP...QT..RE...TQRCEGAKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.FCHGTCS....SYF.IPR....M.N....S....KKLK...-A.............................................VFK.SCAACAPKDYD.RF...........DVTL...D.C......PG.........Q.Q...P...P..Q.I...T...K...S...I....I....K....I.....K.....KCECI--nl................................................
A0A2Y9DT85_TRIMA/1-111                 ..............................................msrtaytvg----------....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A5F8HB26_MONDO/50-156                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCKS.KTILN......R.FCYGQCN....SFY.IPR....H.V....K....KDEE...--.............................................SFQ.SCAFCKPHRVT.SV...........LVEL...E.C......PG.........L.V...P...P..F.R...H...K...K...I....Q....K....V.....-.....-------plgk..............................................
A0A2K6A7K6_MANLE/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A4Z2H759_9TELE/66-176                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.D....Y....QDGD...--.............................................VFQ.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...K...K...R...I....Q....R....V.....K.....QCRCTT-i.................................................
BURS_APIME/11-118                      .............................................vlicllneta----------....---.--...-K...AI..IG...VDECQATPVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........-.-...A...K..P.G...E...K...K...F....R....K....VitkapL.....ECMC---rpc...............................................
G3RT16_GORGO/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
T1H9U3_RHOPR/1-60                      ...................................................masa----------....-LS.SS...EH...KA..QQ...IDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYI.QPF....K.-....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------fgiysc............................................
A0A5E4MVH6_9HEMI/24-128                ............................................dggngvvvtar----------....---.--...--...--..-S...NDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..Q.G...E...K...K...F....R....K....V.....TtkaplECMC---rpc...............................................
A0A2K5ZPA8_MANLE/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--lk................................................
A0A0M9AB08_9HYME/17-132                .....................................tatlhahrehkvhnivly----------....---.--...--...-P..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......tN.N...P...I..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A6G0J4V5_LARCR/152-255               ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
G1RIB3_NOMLE/25-140                    ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A060YNB3_ONCMY/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........iE.N...T...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A226NDT9_CALSU/75-185                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
G1SCR6_RABIT/84-176                    ...............................................xxxxxxxx----------....---.--...--...--..--...------XPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A369S0B9_9METZ/54-165                ....................................dsinshhsygisqlpiapn----------....---.--...--...--..-Q...KAWCKLAKIE.......Q.VLS.....H..P...GCIS.KTISN......H.ICVGQCY....SYR.IPK....S.Y....P....PEAG...QE.............................................NLQ.HCECCHVVDHT.WN...........TVEL...K.C......PT.........-.L...K...N..N.V...D...K...L...V....Q....Y....I.....R.....SCDCRR-c.................................................
A0A423T126_PENVA/33-144                ......................................ggnthhhkvhnlvlnpe----------....---.--...--...--..-Q...HSLCELKHIR.......Q.IVT.....H..A...HCTS.KEMEN......Y.VCVGTCF....SYT.VPQ....T.E....P....ETPG...DE.............................................LLD.YCDSCQASESH.WT...........TIEL...D.C......EE........yG.N...G...Y..T.V...N...K...N...I....Q....M....I.....T.....NCSCS--pc................................................
A0A091UXF7_NIPNI/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A4W5NCD4_9TELE/65-175                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TYTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
G1QAZ6_MYOLU/61-165                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..L-...SDWCKTQPLR.......Q.TLG.....E..E...GCRS.RTVLN......R.FCYGQCN....FLS.TSR....G.H....G....AQEE...-A.............................................SFQ.SCASASRSASA.SV...........LVGA...R.L......PR.........P.D...P...P..F.R...L...K...K...-....-....-....-.....-.....-------svnlsd............................................
A0A2P4T5C7_BAMTH/143-250               .................................................filrkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.SVA.....H..E...SCEK.VIVQN......N.LCFGKCS....SFH.VPG....P.D....D....H---...--.............................................LYT.FCSKCLPTKFS.MK...........HLDL...N.C......T-.........-.S...S...V..P.V...V...K...K...V....M....I....V.....E.....ECNCET-q.................................................
A0A4U1EY90_MONMO/187-296               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPDKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....ECQCKV-k.................................................
H3AQ07_LATCH/25-124                    ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLI.HCDSCMPATSM.WE...........IVTL...E.C......PG.........N.E...E..mP..R.V...D...K...L...V....E....K....I.....L.....RCSCQA-c.................................................
A0A3L8S0M9_CHLGU/109-185               ..............................................lsphssccl----------....---.--...--...--..--...----------.......-.---.....-..-...----.----C......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.E...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2K5CHU4_AOTNA/76-188                ...............................................rlqrgqdk-------AAA....VTL.PL...NP...QE..VT...RGMCKAVPFV.......Q.VLS.....R..P...GCSA.ARLQN......H.LCFGHCS....SLY.VPD....S.D....P....T---...--.............................................PLV.LCNSCMPARKR.WA...........PVVL...W.C......HA.........-.G...S...S..A.S...R...R...R...VkmstE....L....I.....E.....ECHCS--pk................................................
A0A3Q3N1N1_9LABR/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QGqnrgqasss..........................grkshnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A3N0XP32_ANAGA/48-158                ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....Q..E...GCRS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KEQE...--.............................................SFQ.SCAFCRPHRFT.SL...........TVEL...D.C......PD.........L.Q...P...P..V.R...Y...R...K...I....Q....R....V.....K.....QCRCMS-v.................................................
A0A341CN89_NEOAA/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPGKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....ECQCKV-k.................................................
M7CA48_CHEMY/49-160                    .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KDEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A1U7SXC7_CARSF/68-181                ...........................................lqrtrrvgvpaa----------....MSL.PL...DP...QE..VT...REVCKAVPFT.......Q.VLS.....R..P...GCAA.THLRN......H.LCFGHCS....SLY.IPG....S.D....S....S---...--.............................................PLV.LCKSCEPTRKH.RA...........SVVL...W.C......HA.........-.G...S...P..A.S...H...R...R...V....K....IstilV.....E.....GCHCS--pk................................................
A0A093CI18_9AVES/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECLCIS-i.................................................
Q6T937_DANRE/64-174                    ......................................................d-EVLDSSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......L.MIY.....E..D...GCQP.RAIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QEDG...--.............................................AFQ.SCSVCKPKSFT.TV...........TYTL...F.C......PG.........Q.T...P...N..T.K...K...K...R...V....R....R....V.....K.....QCRCTS-v.................................................
A0A1S3SNM2_SALSA/70-180                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...S..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
K7GHD2_PELSI/69-179                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.HTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
L5K2K8_PTEAL/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
G1SZ55_RABIT/135-244                   ...............................................hhfmfrks--------PAs.qgIIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...DCEE.VVLQN......N.LCFGKCG....SVH.FPE....A.V....P....H---...--.............................................LHT.FCSHCSPAKST.TM...........HLQL...N.C......T-.........-.G...V...P..P.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A093JDW3_EURHL/71-176                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....EC-----..................................................
A0A093GJK1_DRYPU/142-249               ................................................hfilkkn-----SASEE....VVL.PI...KT...NE..MH...EENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVEN......N.LCFGKCN....SFH.VPG....P.D....H....L---...--.............................................-YT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A6Q2ZCK3_ESOLU/19-107                ......................................csaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....R..N...ICTQ.-----......-.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQHR.HP...........SV--...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------dklvaiihcslmq.....................................
A0A087QKY8_APTFO/31-131                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
G1SSI3_RABIT/178-290                   ...........................................qrtpevtatpvp----------....--L.PL...DP...QE..VT...QEVCKAVPFT.......Q.VLS.....R..P...GCST.ARVHN......H.ICFGRCT....SLY.VPG....S.D....P....T---...--.............................................SLA.LCNGCEPARQR.RA...........PVVL...W.C......RG.........G.G...G...R..A.F...P...R...R...V....R....MstvlI.....D.....SCQCS--pk................................................
A0A3P8T8T0_AMPPE/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A4W3HDK9_CALMI/48-154                ....................................................kea--VLDSSRK-....AVI.VT...ER...RH..VH...QDWCKSHPFN.......Q.TLR.....E..N...GCVS.RTVIN......R.FCYGQCN....SFY.IPG....S.P....P....----...--.............................................-FR.SCSFCKPKRFV.SV...........TIIL...N.C......PA.........L.Q...P...P..S.R...H...R...R...V....Q....L....V.....K.....ECRCVS-i.................................................
F1R4W0_DANRE/64-189                    .....................................................kh-DMLSSSRE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....L..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.L....T....SQSS...HRsrktas.................................tpdhttSFQ.SCAFCRPSRIT.TV...........TVRL...H.C......PG.........L.Q...P...P..Y.R...Q...R...K...V....Q....R....I.....K.....QCKCVS-v.................................................
A0A482WIX7_LAOST/12-122                .........................................vlaaliischchhd----------....---.--...--...-A..WR...RPGCHKVGHT.......R.TIS.....I..P...DCVE.FPITT......N.ACRGFCE....SWS.VPS....T.L....E....TVLTn.pHQ............................................aVTS.IGQCCNIMDTE.DI...........EVRV...L.C......L-.........-.-...D...G..T.K...D...L...V...F....K....S....A.....R.....SCSCY--hck...............................................
A0A1U7S2R8_ALLSI/126-233               .................................................ftlqkn-----SASEE....VVL.PI...KT...DE..MH...QETCWTLPFS.......Q.GIV.....H..E...NCEK.AVVQN......N.LCFGKCN....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPAKFN.LK...........RLEL...N.C......T-.........-.K...S...V..P.I...V...K...V...V....V....I....V.....E.....ECKCEI-q.................................................
A0A091LT92_CARIC/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYA.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A2K6AP00_MACNE/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
S7NNJ6_MYOBR/109-209                   ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A183IUV9_9BILA/105-223               .........................................lqvpqtqrmppdkp----------....GMV.IA...TA...DA..FQ...KDMCRTMRLK.......Q.RIS.....V..R...GCVS.KTVVN......S.FCYGQCN....SFF.IPE....P.R....G....FGTR..lRP.............................................AFE.SCSVCKPRELT.RI...........TIKL...H.C......PM.........R.E...R...T..V.L...T...R...T...Y....L....K....V.....K.....RCVCT--pq................................................
F7BVG5_HORSE/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2R9CDM1_PANPA/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A0B1TTI9_OESDE/1-53                  .................................................mnskal----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.-------....---.---....-.-....-....----...KA.............................................KFK.SCAACAPRDYD.AV...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....I....K....I.....K.....KCECI--dl................................................
H3ABK4_LATCH/76-186                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPRKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..T.K...K...K...K...I....T....R....V.....K.....QCRCIS-i.................................................
A0A6G1AJP0_CROCR/23-122                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCTPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A383ZJS0_BALAS/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSL.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2Y9IMH2_ENHLU/127-237               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A093CJR5_TAUER/71-163                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...-...-..-.-...-...-...-...-....-....-....-.....-.....-------p.................................................
A0A672URG6_STRHB/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A484B4D7_DRONA/28-141                ....................................klcmaqsegtatatendig----------....---.--...--...--..HL...GDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK........vK.H...G...E..R.K...F...K...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A1S3F381_DIPOR/52-162                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQSLR.......Q.TVS.....E..E...GCRS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHRLT.SA...........IVEL...D.C......PG.........Q.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A182Y3E8_ANOST/6-118                 ..............................................fmsvlfcai----------....-ML.VK...AR...ET..WQ...KPGCHKVGHT.......R.KIS.....I..P...DCVE.FTITT......N.ACRGFCE....SFA.VPS....A.P....F....ALVG...HKpp.........................................qpVTS.VGQCCNIMETE.DV...........RVRV...L.C......V-.........-.-...N...G..I.R...N...L...T...F....K....S....A.....T.....NCSCY--hc................................................
A0A091RDK3_9GRUI/143-251               ................................................nfmlkkn-----SASEE....VIL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....PFH.VAG....P.G....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...A...V..P.V...V...K...E...V....M....I....V.....E.....ECRCET-p.................................................
A0A4Z2J2F8_9TELE/146-258               ............................................qrainkgdkms----------....LSM.PI...NL...KD..T-...KQACTAVPFT.......Q.RVT.....A..D...GCDA.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....LAGTg.pLR.............................................HRA.PCSRCSPSRTH.TV...........TVPL...R.C......--.........-.G...A...K..V.H...V...R...R...V....M....V....V.....E.....ECKCET-s.................................................
A0A662YQ50_ACIRT/341-451               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................SFQ.SCSFCKPKRFT.TM...........TVTL...N.C......PE.........L.Q...P...P..T.K...R...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
G3SRD8_LOXAF/75-190                    .........................................etmqsgrevatatt----------....VFL.PL...DP...QE..LA...RETCKAMPFT.......Q.VLS.....R..P...GCTA.TRLRN......H.LCFGHCS....SFY.VPS....S.D....A....S---...--.............................................PII.LCSSCVPTRKR.WT...........PVVL...W.C......RA.........G.S...P...A..S.RrqvK...T...S...T....M....L....V.....E.....GCQC---gpk...............................................
E2C0S4_HARSA/460-574                   ....................................asldahrehkvhnivlypd----------....---.--...--...--..-K...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...M..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
H0Y0D8_OTOGA/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRAT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...H...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A401NP66_SCYTO/68-178                .....................................................qd--VLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TIN.....E..D...GCVS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....RDQE...--.............................................SFQ.SCAFCKPQKFT.TL...........TVKL...N.C......PD.........L.Q...P...P..F.R...H...K...K...I....Q....R....V.....K.....QCKCIS-v.................................................
A0A2K6SEX7_SAIBB/16-122                ..........................................vtegwgqeaaipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLK.KV...........KVQL...H.C......V-.........-.G...S...Q..R.E...E...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A3N0Y0N2_ANAGA/7-79                  ..........................kcilgqcadkqevlassqeavvvmqmqpl----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.-------....---.---....R.Q....-....-TKE...QE.............................................SLQ.SCGFCRPHRFT.SL...........TVEL...D.C......Y-.........-.-...-...-..-.-...-...S...K...I....Q....S....V.....K.....QCHCVS-v.................................................
A0A368H8L7_ANCCA/25-107                ........................................mlllvsshhtiaygv----------....---.--...--...--..--...KYHCRKVGAE.......E.IID.....E..R...GCEL.MILRV......N.RCSGHCL....SFT.FPN....P.I....T....GKTS...--.............................................--V.HAKCCRMTDTE.WQ...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------nlpslyts..........................................
A0A1A6GWN0_NEOLE/57-167                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEED...--.............................................SFQ.SCAFCKPQRVT.SV...........IVEL...D.C......PG.........L.D...P...P..F.R...I...K...K...I....Q....K....V.....K.....HCRCMS-v.................................................
G3WQ25_SARHA/74-186                    ..............................................rpqeeeems---------A....VSL.PL...SA...QE..VV...RETCKAVPFT.......Q.VVS.....R..P...GCTS.IRLQN......K.FCFGRCS....SFY.IPS....A.G....L....G---...--.............................................RPH.LCNSCLPSRRR.RV...........PVVL...W.C......RG.........V.G...R...PfsY.K...R...R...K...V....St..lV....V.....E.....ACQCQT-h.................................................
A0A2U9BQ81_SCOMX/127-237               ............................................qraidkgdkls----------....--L.PV...NF...KD..T-...KQTCTALPFT.......Q.RVT.....A..D...GCDT.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FTGTg.aLR.............................................HRA.PCSRCAPSKAQ.TV...........TVPL...R.C......--.........-.G...A...Q..V.R...Q...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A3P8UBQ7_AMPPE/120-237               ...........................................qmwqrafgkggk----------....TTL.PI...NL...KD..T-...KQTCTAVPFT.......Q.HVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FAGL...SPgtg.......................................tfqRRG.PCSRCAPFKAH.TV...........TVPL...R.C......--.........-.G...A...E..L.R...E...K...R...V....M....L....V.....E.....DCKCET-s.................................................
G5BZL2_HETGA/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTM.WE...........IVTL...E.C......PG.........H.E..vM...P..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
GREM1_HUMAN/71-181                     ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
#=GR GREM1_HUMAN/71-181          SS    ......................................................X---BSSHHH-....HHH.HH...HH...TT..SS...--EEEEEEEE.......E.EE-.....-..T...TS--.EEEEE......E.EEEEEEE....EEE.EEE....E.E....T....TCEE...--.............................................EEE.EEEEEEEEEEE.EE...........EEEE...E.-......TT.........S.S...S...S..E.E...E...E...E...E....E....E....E.....E.....EEEEEE--.................................................
A0A2K5F187_AOTNA/52-152                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A6G0U4W6_APHGL/34-143                .....................................tnstlrrhkvhnivlypd----------....---.--...--...--..-K...HSWCTSTPIK.......Q.VIS.....D..V...DCDP.VEIDN......L.VCLGACF....SYS.IPR....T.V....P....ANNG...DE.............................................VNS.YCDSCQPINTI.WI...........PVKL...K.C......S-.........-.D...G...S..N.H...T...K...K...V....Q....L....I.....K.....ECRCSS-c.................................................
A0A1V4JKK1_PATFA/73-184                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A4W5L0B9_9TELE/47-156                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.AIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........Q.S...P...S..T.Q...K...K...R...V....Q....R....V.....K.....TCH----ldm...............................................
A0A091QXC9_9GRUI/71-176                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....EC-----..................................................
A0A1J1ILV4_9DIPT/127-255               ......................................................d-KILKSSKS-....ALF.IA...KK...EL..LK...QDWCKTEPFE.......Q.KIR.....E..D...GCYS.KKVIN......N.FCYGQCN....SFY.VPK....T.P....R....RRRR...NHrnqrdhrv.............................rqshnnvdSFR.SCAYCKPKEYT.FV...........NVIL...K.C......PS.........L.T...P...N..Y.R...R...K...R...I....Q....I....V.....K.....ECRCIA-q.................................................
A0A1U7T926_CARSF/25-140                ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2Y9GK44_NEOSC/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A340XMF2_LIPVE/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
G3S6C5_GORGO/25-140                    ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
V9KYQ7_CALMI/48-158                    .....................................................qd--VLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TIN.....E..D...GCMS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....REQE...--.............................................SFQ.SCAFCKPQKFT.TL...........TVKL...N.C......PD.........L.E...P...P..F.R...H...K...K...I....Q....R....V.....K.....QCKCIS-v.................................................
A0A091PX26_HALAL/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
V8NQX1_OPHHA/127-233                   ..................................................klktk-----SRSEE....VIL.PI...KI...SE..IY...QEVCNKLPFS.......Q.SIT.....H..E...NCDK.VVIQN......N.LCFGKCS....SFH.VPA....V.D....D....R---...--.............................................IYS.FCSLCLPTKFS.MK...........HLKM...N.C......T-.........-.M...A...N..P.V...N...K...M...V....M....I....I.....E.....ECKCEV-q.................................................
A0A4W6EH45_LATCA/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCHS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QGqsrgqasgs..........................grknhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
L9L0J8_TUPCH/126-225                   ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A5J5D5S9_9PERO/29-142                ....................................assnkasdnghphlgdsdp----------....---.--...--...--..--...-ERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A1S3PQL7_SALSA/25-141                .................................................vvqass------SKTE....SGH.ST...HH...GD..TE...PDRCMRHHFV.......E.TIT.....H..Si.yKCNS.NMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCKPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A672JGG7_SALFA/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QGqsrgqasgs..........................grkshnkiqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
B4JHI8_DROGR/28-141                    ..................................klcmaqsdnavsrndndighl----------....---.--...--...--..--...GDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK........vK.H...G...E..R.K...F...K...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A4U5UNF8_COLLU/66-176                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIN.....E..E...GCMS.RTIIN......R.FCYGQCN....SFY.IPR....H.N....Y....QDGD...--.............................................VFQ.SCSACKPKTFS.TV...........TYTL...Y.C......PG.........Q.T...P...S..T.R...K...K...R...I....Q....R....V.....K.....QCRCTT-i.................................................
A0A3P7HWG2_ANGCS/27-116                .........................................ksycflpksvlgae----------....---.--...--...--..--...----------.......E.IID.....E..R...GCEL.VILRV......N.RCSGQCL....SFS.FPN....P.I....T....GRTS...--.............................................--V.HAKCCRMTDSE.WV...........TTEL...M.C......N-.........-.-...D...G..P.R...P...I...K...I....P....S....A.....V.....QCDCF--dc................................................
H2MUB2_ORYLA/52-162                    ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..E...GCLS.RSIIN......R.FCYGQCN....SFF.IPR....H.V....Y....EDDS...--.............................................AFK.SCSACKPRTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...R...K...R...V....Q....R....V.....K.....QCRCGT-v.................................................
A0A2I3TVF0_PANTR/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
H2NXQ8_PONAB/77-188                    .............................................lqggqdevaa----------....VTL.PL...NP...QE..VI...QGMCKAVPFI.......Q.VFS.....R..P...GCSA.IRLRN......H.LCFGRCS....SLY.IPG....S.D....P....T---...--.............................................PLI.LCNSCMPARKR.WA...........PVVL...W.C.....lTG.........S.S...A...S..R.R...R...V...K...Is..tM....L....I.....E.....GCHCS--pk................................................
A0A673V167_SURSU/21-122                ......................................dtdsktdssfmidsdpl----------....---.--...--...--..--...--RCMRHHYV.......D.SIS.....H..Pl.yKCSS.KMVLL......A.RCEGHCSq..aSRS.EPL....V.S....F....STVL..kQP.............................................FRS.SCHCCRPQTSK.LK...........ALRL...R.C......SG.........G.M...-...-..-.-...-...-...-...-....-....-....-.....-.....-------rltatyrs..........................................
A0A5E4MAY9_9HEMI/21-129                ......................................nstfrkhkvhnivlypd----------....---.--...--...--..-K...HSWCTSTPIK.......Q.VIS.....D..V...DCNP.VEIDN......R.VCLGACF....SYS.IPR....T.L....P....VNNV...DE.............................................VNS.YCDSCQPIKTL.WI...........PVQL...T.C......T-.........-.D...G...S..N.R...T...K...H...V....Q....L....I.....N.....ECRCSS-c.................................................
A0A368FC32_ANCCA/12-86                 ...............................................adhcsfff----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......R.FCHGTCP....SYF.IPR....M.N....S....KMLK...-A.............................................KFK.SCAACAPRDYD.AV...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....V....K....I.....K.....KCECI--dl................................................
A0A669DVU0_ORENI/28-143                .....................................sasssnkasdnghahlgd----------....---.--...--...--..AD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......T-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A0P7X4V3_SCLFO/121-231               ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCAS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPRRFT.TM...........TFTL...N.C......PE.........Q.Q...P...P..T.K...K...K...R...V....Q....R....V.....K.....QCRCIS-i.................................................
A0A674BIX1_SALTR/25-141                ...............................................vvhasssk--------AE....NGH.ST...HL...GD..TD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
C6SUP8_STRPU/20-125                    ...................................................lpml----------....---.-T...HA...HY..WE...SPGCHLVGYT.......K.KVR.....I..P...GCRE.TKVQM......N.ACRGFCQ....SYS.YPS....N.L....A....TLQN...SDyt.........................................qiFTT.HGSCCSIATTH.DV...........NIRL...Q.C......L-.........-.D...N...Y..E.Y...V...D...T...F....K....S....A.....A.....SCECS--lc................................................
G1KUD8_ANOCA/130-237                   ...............................................fmlkakpr-------SEE....VVL.PI...KT...NE..KY...QDICNTLPFS.......Q.TIA.....H..E...NCEN.LVIQN......N.LCFGKCS....SFH.VPG....L.E....D....R---...--.............................................LYT.FCSHCLPTKFS.MK...........RLEM...N.C......T-.........-.R...A...L..P.V...V...K...V...A....M....I....V.....E.....ECRCEV-q.................................................
A0A151P192_ALLMI/2631-2734             ..........................................ssrlsrkgkncvl----------....---.--...-T...DE..MH...QETCWTLPFS.......Q.GIV.....H..E...NCEK.VVVQN......N.LCFGKCN....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPAKFN.LK...........RLEL...N.C......T-.........-.K...S...V..P.I...V...K...V...V....V....I....V.....E.....ECKCEI-q.................................................
A0A2U3XFV2_LEPWE/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3Q3E1N9_9LABR/26-128                ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........A.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A670J911_PODMU/44-143                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPALSM.WE...........VVTL...D.C......PS.........N.E...D..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A669E6X8_ORENI/55-187                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCHS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSS...QGqsrgqtsgs..........................grknhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A0Q3MLB3_AMAAE/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A091P798_LEPDC/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q0IQE1_DIACI/21-134                .....................................ssvthkehkvhnivlypd----------....---.--...--...--..-K...HSWCKTTPIK.......Q.VIT.....H..P...GCKS.VEIDN......N.VCVGACF....SYS.IPR....T.E....P....ETQG...-E.............................................VLP.YCDSCQPSHIK.WK...........HVTL...E.C......PDs......dyE.E...D...N..V.M...T...K...R...V....E....M....I.....D.....GCACTS-c.................................................
A0A212F3K0_DANPL/10-114                ...............................................ltlshllv----------....---.--...-A...QS..YK...KPGCHRQGHT.......R.SIS.....I..P...DCVE.FKITT......N.ACRGYCE....SYS.LPS....I.M....L....GFKR...HP.............................................VTS.LGQCCNIMESE.DI...........PVKV...L.C......LD.........G.E...R...N..L.V...F...-...-...-....K....S....A.....V.....TCACY--hcqk..............................................
A0A3P8Z5J2_ESOLU/27-141                ......................................qgssskvesghnapmgd----------....---.--...--...--..TD...PDRCLRHHYV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFRS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A3M0KJG1_HIRRU/272-382               ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A6G0HNJ4_LARCR/131-263               ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QSqnrgqasgs..........................grkshnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
G3WT36_SARHA/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2U3WJR0_ODORO/127-237               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3Q2CS50_CYPVA/27-142                ......................................qaassskagdkghqqlv----------....---.--...--...-D..TD...PERCMRHHFV.......E.TIT.....H..Pv.yKCNT.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.FCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A091U6Y7_PHORB/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...N...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A093FYV4_GAVST/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...NCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFF.MK...........RLDL...N.C......T-.........-.S...S...G..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A1U8C549_MESAU/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEED...--.............................................SFQ.SCAFCKPQRVT.SV...........VVEL...E.C......PG.........L.D...P...P..F.R...I...K...K...I....Q....K....V.....K.....HCRCMS-v.................................................
A0A556UFD9_BAGYA/183-293               ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TLH.....E..E...GCVS.ITILN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPRRFT.TM...........TYTL...S.C......PD.........L.Q...P...P..T.R...K...K...R...V....Q....R....V.....K.....QCRCIS-i.................................................
A0A452IPC8_9SAUR/23-122                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.A...E..iP..R.V...D...K...L...V....E....K....I.....L.....RCSCQA-c.................................................
A0A5F8ADP5_MACMU/251-350               ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1S3PQP6_SALSA/70-180                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TYTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A0K0CVS4_ANGCA/2-95                  ....................................................rpv----------....---.--...--...--..--...-QRCEGAKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.FCHGTCS....SYF.IPR....M.N....S....KKLK...-A.............................................VFK.SCAACAPKEYD.RF...........DVTL...D.C......PG.........Q.N...P...P..Q.V...T...K...S...I....I....K....V.....G.....KCECI--el................................................
T1FTY2_HELRO/180-334                   ......................................................k-NQMKGEMNE....KIV.MD...KK...AY..LK...EDWCKTKRYN.......L.EIK.....E..P...GCLA.KNIKN......N.FCYGQCN....SFY.IPR....N.P....I....KTFA..yVDqqsnfktnktpgkeiiyree.....eeededdgdteddgsmqskdYFM.SCASCVAQSVK.WK...........KVVL...N.C......PR.........K.R...P...P..Y.V...V...K...K...V....R....V....V.....Q.....RCKCVA-v.................................................
A0A2K6SAN9_SAIBB/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
B4M141_DROVI/29-142                    ..................................lcmaqadgaaagandndighl----------....---.--...--...--..--...GDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK........vK.H...G...E..R.K...F...K...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A091UJG2_NIPNI/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A6A5ECN7_PERFL/66-176                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIQ.....E..E...GCLS.RTILN......R.FCYGQCN....SFY.IPR....H.N....Y....QDGD...--.............................................AFQ.SCSACKPKTFS.TI...........TYTL...F.C......PG.........Q.T...P...S..T.R...K...K...R...I....Q....R....V.....K.....QCRCTT-i.................................................
A0A4C1UA74_EUMVA/12-89                 ................................................lgqifav----------....---.--...--...EE..WK...RAGCHLTGYT.......R.NIS.....I..P...DCVS.FRITT......N.ACRGYCE....SWS.LPS....I.M....L....GFK-...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------rhpvtslgqccnimesedqdtp............................
A0A2R9CDS4_PANPA/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A226PB61_COLVI/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
H9G2X9_CAEEL/221-334                   ....................................dtvfegrkhallqladpda----------....---.--...--...-L..IM...NQRCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGACA....SIF.IPR....M.H....S....KKLK...-A.............................................AFR.SCAACAPAEYD.YV...........DITL...D.C......PG.........R.T...P...P..T.A...T...K...T...I....V....K....V.....K.....SCKCKE-q.................................................
A0A3P8UA88_CYNSE/73-183                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCLS-i.................................................
A8Y489_CAEBR/241-354                   ..................................................dtvle-----GRKHA....LLQ.LA...DP...DA..LR..mNQRCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGTCA....SIF.IPR....H.S....T....KKLK...-A.............................................AFR.SCAACAPSEYD.YV...........DITL...D.C......PG.........K.S...P...P..T.T...T...K...T...I....V....K....V.....K.....SCKCRE-v.................................................
A0A1S3IPV6_LINUN/19-125                .......................................gqdahpplqsivfhse----------....---.--...--...--..-S...HTWCESRPIQ.......Q.ILT.....Q..P...GCES.QSVEN......K.VCVGQCY....SYS.VPN....T.L....P....SQNA...-G.............................................LLQ.RHDVCKPARAR.WE...........KVTL...Q.C......A-.........-.N...G...H..M.L...P...K...F...V....Q....I....I.....E.....ECACAS-c.................................................
K7F1G2_PELSI/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A663EN91_AQUCH/54-165                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
H2QX07_PANTR/135-244                   ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A093R8P8_PHACA/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.G...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A226PW05_COLVI/75-185                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A093EZL7_TYTAL/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
G1N1X7_MELGA/142-207                   ................................................hfmlrkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.SVA.....H..E...NCEK.VIVQN......N.LCFGKCS....SFH.VPG....P.D....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------dr................................................
A0A3Q2ZAN7_KRYMA/59-169                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTVIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A3Q2E8N0_CYPVA/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......H.FCYGQCN....SFY.IPR....H.L....G....PSLG...HGqnrgqnsgs..........................grkghnkgqePFQ.SCSFCRPHSIK.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
G1PZV5_MYOLU/126-236                   ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
C6SUP7_CAERE/22-120                    .............................................scllqycsag----------....---.--...--...-V..TK...NNSCKKVGSE.......E.LID.....E..E...GCDL.MIIRI......N.RCSGHCF....SFT.FPN....P.L....T....KKY-...--.............................................-SV.HAKCCRMVEWE.ML...........ETEL...K.C......S-.........-.-...E...G..N.R...K...L...R...I....P....S....A.....T.....QCECF--dc................................................
A0A0J7L645_LASNI/18-133                ....................................sahldahrehkvhnivlyp----------....---.--...--...--..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qK.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A093BVU0_9AVES/31-131                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
T1JJS2_STRMM/4-114                     ..............................................lvfmvaamm----------....--C.IF...SS...RL..AT...ADECHITPVI.......H.VLK.....Y..P...GCNQ.KPIPS......F.ACQGRCT....SYV.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQEMGVR.EA...........NVTL...H.C......PHa......rpG.E...P...K..F.R...K...V...T...T....R....A....P.....V.....DCMC---rpc...............................................
A0A0V1H445_9BILA/167-286               .............................................rqqqqqrqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....ARLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMS-v.................................................
A0A2A2J1S6_9BILA/31-106                ............................................ccfstacagli----------....---.--...--...--..--...-KECRVVGAE.......E.LID.....E..E...GCDL.SIVRV......N.RCSGQCL....SFS.FPN....P.N....T....RKNT...-V.............................................HAK.CC---------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------rmvdsewvsneslh....................................
A0A2K6RTP8_RHIRO/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A0V0SDK7_9BILA/158-277               .............................................qrskqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
A0A164WQ02_9CRUS/26-135                ..........................................llasitlvilglv----------....---.--...--...SD..VR...ADECHLTPVI.......H.VLQ.....Y..P...GCIP.KPIPS......F.ACTGKCT....SYV.QVS....G.S....K....L---...WQ.............................................TER.SCMCCQESGER.EA...........TVSL...L.C......PKa......apG.E...P...K..L.R...R...V...V...T....R....A....P.....V.....DCMC---rpc...............................................
F7BL17_XENTR/69-179                    ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..D...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................SFQ.SCSFCKPKKFT.TM...........VVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...I....T....R....V.....K.....QCRCIS-i.................................................
A0A2Y9DTA1_TRIMA/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A673XPI5_SALTR/25-141                ................................................vvqasss-------KTE....SGH.ST...HH...GD..KE...PDRCMRHHFV.......E.TIT.....H..Sm.yKCNS.NMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCKPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A665T9J3_ECHNA/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A341BRT3_NEOAA/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
V8NNP9_OPHHA/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3P8UX55_CYNSE/51-159                ...................................................qkpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....E....P---...--.............................................-FQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
G3VXI3_SARHA/51-168                    ......................................................n-KTMNRAENGg.ryPHH.PL...EP...KD..AS...DYSCRELHFT.......R.YIT.....D..G...PCRSaKPVTE......L.VCSGQCG...pAHL.QPN....A.I....G....RKWL...WR.............................................QSA.ADYRCIPDRYR.TQ...........RIPL...L.C......PG.........-.G...E...E..A.R...T...H...K...I....R....V....V.....V.....SCKCKR-y.................................................
I3MQY1_ICTTR/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E..vV...P..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
F6YPZ6_HORSE/72-183                    .............................................rqpgqqvata----------....LSL.PL...DP...QE..VA...REMCRAVPFT.......Q.VLS.....R..P...GCIA.VRLRN......H.LCFGHCS....SVY.VPG....S.G....P....T---...--.............................................PRV.LCNSCVPAHRR.RV...........PVAL...W.C......SA.........G.R...P...-..A.S...Q...R...R...V....MtstvL....V.....K.....GCQCS--pr................................................
A0A194PU44_PAPXU/165-282               ......................................................r-KILKSSKN-....ALF.VT...KK...EY..LK...EDWCKTEPLV.......Q.KIR.....E..P...GCLP.TTVIN......K.FCYGQCN....SFY.IPK....G.P....R....RRDG...NEer........................................pppAFK.SCSFCKPKKFT.WM...........TVTL...R.C......PG.........Q.N...P...P..F.K...R...K...R...L....Q....K....V.....K.....QCKCL--pv................................................
A0A094LF96_PODCR/51-161                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K6GQ93_PROCO/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A553RQN4_9TELE/523-633               ......................................................q-EVLSSSQE-....ALV.VT...ER...KY..LR...SDWCKTQPLR.......Q.TVR.....L..D...GCRS.RTIIN......R.FCYGQCN....SFF.IPR....Q.A....Q....KMPD...--.............................................SFQ.SCGFCRPQQFS.RL...........TLEL...T.C......PE.........L.M...P...P..V.R...Y...R...K...I....Q....R....V.....K.....NCRCTA-l.................................................
A0A2K5R514_CEBCA/16-122                ..........................................vsedwgqeaaipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLK.KV...........KVQL...H.C......V-.........-.G...S...Q..R.E...E...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A3KFI5_HUMAN/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
F7HBP1_MACMU/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q2DK94_CYPVA/22-131                ......................................hsaaapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A3Q3F6R8_9LABR/25-140                ...................................qsassnkasdnahphlgdsd----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A1S2ZMP3_ERIEU/26-140                ...........................................ktgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A091PZ60_LEPDC/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
G1PUY0_MYOLU/136-245                   ................................................hrfmfrm----SPASQG....VIL.PI...KS...HE..VH...QETCRTLPFS.......Q.TVT.....H..E...DCEE.VVVQN......N.LCFGKCG....SAR.FPG....A.A....R....H---...--.............................................PHT.FCFHCSPARFT.TM...........HLPL...N.C......S-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A3P8TVY4_AMPPE/28-142                ....................................sassnkasdnghphlgdad----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A0K0EFE2_STRER/75-193                ..............................hshkktykkrkekfqvsfegissfp----------....---.--...--...--..QH...KTECKAEEIN.......V.IVN.....Y..N...NCIS.REITN......K.YCSGTCY....SIF.IPK....L.R....Q....QKLK...-E.............................................SFQ.MVSSCVPVEYE.VI...........KIRL...E.C......PN.........Q.E...P...N..H.V...Y...R...Q...F....V....K....V.....N.....SCSCKQ-f.................................................
G3QGR9_GORGO/135-244                   ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A2J7PJC7_9NEOP/2-99                  ...................................................fvea----------....---.--...--...--..--...KDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........NVSL...F.C......P-.........-.K...A...K..A.G...E...R...K...F....R....K....V.....NtkaplECMC---rpcs..............................................
A0A671FYF0_RHIFE/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q4N2N0_NEOBR/127-241               .................................................qkvidk------GGK-....MSL.PV...NL...KD..M-...KQTCTAVPFT.......Q.HVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FEGL...SPdtg.......................................afhRRA.PCSRCAPSKAQ.TV...........TVPL...R.C......--.........-.G...A...D..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
H2MQY0_ORYLA/70-180                    ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................AFQ.SCSFCKPKRFT.AM...........TFTL...N.C......PD.........Q.Q...P...P..R.K...R...K...R...I....M....R....V.....K.....QCRCIS-i.................................................
BURS_DROME/28-141                      ....................................klctaqpdssvaatdndit----------....---.--...--...--..-H..lGDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A091JJS7_EGRGA/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K6S784_SAIBB/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A6J3R8W8_TURTR/77-184                ............................................rmqhgqdvaxs----------....LSL.PL...DP...QE..VA...QEMCKAVPFT.......Q.VLS.....R..L...GCMA.VYFLN......H.LCFGHCS....SFY.IX-....-.-....-....----...--.............................................PFI.LCNSCVPARTR.WA...........PVVL...W.C......WA.........G.S...P...A..S.RrqvK...M...S...T....V....R....V.....E.....GCQCR--pk................................................
A0A3S2TSN9_CHISP/4-112                 .......................................iqdklaeaqdiqimss----------....---.--...--...--..--...GQECQMTPVI.......H.VLR.....H..P...GCKP.KAIPS......F.ACIGKCS....SYV.QVS....G.S....K....I---...WQ.............................................MER.TCNCCQESGER.EA...........TVVL...F.C......P-.........-.K...A...K..S.E...E...K...R...F....M....K....V.....StkaplECMC---rpc...............................................
E9FS72_DAPPU/25-163                    .......................................................KNLLQTSPKD....ALI.VT...KR...RF..LR...KDWCQSQPLI.......Q.RIG.....Q..D...QCLS.ATVLN......R.FCYGQCN....SFF.IPK....N.Q....L....KEDD..gTDrqvargegdeaag...................avlggagiaatakAFR.SCAVCQPKKTS.WV...........TVTL...K.C......PS.........L.V...P...N..I.R...R...R...R...V....L....I....I.....N.....QCRCM--..................................................
H2L366_ORYLA/20-124                    ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...N.C......PG........sE.E...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
B3LVH1_DROAN/28-141                    ....................................klcsaqadnavsssdndit----------....---.--...--...--..-H..lGDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A665X8E7_ECHNA/135-250               .............................................qravdkgtkt----------....VPL.PV...SL...KD..T-...KQTCTAVPFT.......Q.RVT.....K..D...GCET.VSVHN......K.LCFGQCS....SLF.VPS....E.G....E....FAGL...APgtg.......................................afhHRA.PCSRCAPSKAH.TV...........TVHL...R.C......--.........-.G...T...E..V.Q...E...R...R...V....M....M....V.....E.....ECKCET-g.................................................
A0A3N0YJW4_ANAGA/27-97                 .....................................................nq--FMFRGKSDf..rYVL.PI...RN...IE..VR...QEKCRALSFS.......Q.RIF.....H..E...NCET.LELQN......N.ICFGKCD....T--.---....-.-....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------spssgeeggsfhca....................................
A0A6G0J8V1_LARCR/127-243               ...........................................qmwqratnkgek---------M...tMSL.PV...NL...KD..A-...KQTCTAVPFT.......Q.RVT.....A..D...GCEA.ITVHN......K.LCFGQCS....SLF.VPS....E.G....D....FAETgalHR.............................................HRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...A...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-s.................................................
A0A2P4SFX2_BAMTH/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
M3YXI9_MUSPF/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A3Q1BQ24_AMPOC/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A6G0ZBL1_APHCR/22-98                 ..................................................pspla----------....---.-T...GS...NT..WQ...KPGCHKVGHT.......R.KIS.....I..P...NCVE.FPITT......N.ACRGYCE....SWA.VPS....P.A....D....T---...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------vminphqritsvgqccnimdte............................
A0A3S2LS28_CHISP/298-415               ......................................................r-KALKSSKN-....ALF.VT...KK...EY..LK...EDWCKTEPLV.......Q.KIR.....E..P...GCIP.TQVLN......K.FCYGQCN....SFY.IPK....G.P....R....RRDN...NEer........................................pppAFK.SCSFCRPKKVT.WI...........TVTL...R.C......PG.........Q.N...P...P..F.R...R...K...R...L....Q....K....I.....K.....QCKCL--pv................................................
D3ZXD0_RAT/50-160                      ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEED...--.............................................SFQ.SCAFCKPQRVT.SV...........IVEL...E.C......PG.........L.D...P...P..F.R...I...K...K...I....Q....K....V.....K.....HCRCMS-v.................................................
A0A6J3QZN1_TURTR/137-247               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A0B2VA44_TOXCA/142-256               ....................................................kda---LKQSQL-....AVK.LG...DA...EA..LR..kNPECEGQLFK.......Q.RIR.....M..E...GCLS.KVVIN......R.FCHGTCS....SYY.IPR....L.R....P....RKLK..lQA.............................................MFQ.SCSACRPSEYD.TI...........EVKL...D.C......PR.........K.V...P...S..Q.L...I...R...R...V....V....K....V.....K.....KCSCIA-l.................................................
A0A402EU98_9SAUR/69-179                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..D...GCNS.KTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKIT.TV...........LVTL...N.C......PE.........L.Q...P...P..S.R...K...K...R...V....T....R....V.....K.....ECRCIS-i.................................................
B9EM59_SALSA/16-124                    .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sD.D...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A6A5DZI8_PERFL/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QAqnrgqasgs..........................grkghnkaqePFQ.SCSFCRPHRIT.QL...........TVEL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....P....R....V.....K.....QCRCMS-v.................................................
H0XIK1_OTOGA/25-125                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A139WDF0_TRICA/126-171               ......................................................r-KLLKSSKN-....ALF.VT...KK...EY..LQ...RDWCKTEPLI.......Q.KVK.....V..E...G---.-----......-.-------....---.---....-.-....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------ifrwssigk.........................................
A0A3P9PD38_POERE/134-248               .....................................................qk--VMDKGGK-....VSL.PV...NL...KD..T-...KQTCTAVPFT.......Q.HVT.....A..D...GCQT.VTVYN......K.LCFGQCS....SLF.VPS....E.G....E....FADP...SPgtg.......................................afrRRA.PCSRCAPFKAQ.TV...........AVPL...R.C......--.........-.G...A...Q..V.W...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A3Q7TRH5_VULVU/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3Q2VHD5_HAPBU/28-143                .....................................sasssnkasdnghahlgd----------....---.--...--...--..AD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......T-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A2I3G4Z7_NOMLE/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A093F1S6_GAVST/71-176                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....EC-----..................................................
A0A093P123_PYGAD/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
G7MHC6_MACMU/58-158                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
S9WGA9_CAMFR/135-244                   ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VIVQN......N.LCFGKCG....SAR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......TG.........-.-...L...D..P.A...V...K...V...V....M....L....V.....E.....ECQCKV-q.................................................
A0A482VQ54_9CUCU/9-119                 .............................................tvlslsnafm----------....VTT.VN...AR...DA..WQ...KPGCHKVGHT.......R.KIS.....I..P...ECVE.FHMTT......N.ACRGFCE....SWA.VPS....G.P....K....ATPT...QP.............................................VTS.VGQCCNIMDTE.PV...........EARV...L.C......V-.........-.-...D...G..V.R...T...L...T...F....K....S....A.....V.....SCSCY--hc................................................
A0A2Y9EJK0_PHYMC/78-184                ............................................lqhgqdvaxsl----------....-SL.PL...DP...QE..VA...QEMCKAVPFT.......Q.VLS.....R..L...GCMA.VYLLN......H.LCFGHCS....SFY.IXP....-.-....-....----...--.............................................-LI.LCNSCVTARTR.WA...........PVVL...W.Cwv..gsP-.........A.S...R...R..Q.V...K...M...S...T....V....R....V.....A.....GCQCR--pk................................................
A0A4W2DPX5_BOBOX/14-124                .......................................lllavtegqsqqaaip----------....---.--...--...--..--...--GCYLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISSLR.KV...........KVQL...H.C......G-.........-.G...N...R..K.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
H0UUY9_CAVPO/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTM.WE...........IVTL...E.C......PG.........H.E..vM...P..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091JQS5_EGRGA/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A6H5IYT9_9HYME/52-162                ........................................qawdssvhnivlypd----------....---.--...--...--..-K...ESWCKTTPIK.......Q.VVT.....W..P...SCAP.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDk.......dD.Q...P...T..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
GREM1_MOUSE/71-181                     ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A087Y6A4_POEFO/128-242               .....................................................qk--VMDKGGK-....VSL.PV...NL...KD..T-...KQTCTAVPFT.......Q.HVT.....A..D...GCQT.VTVYN......K.LCFGQCS....SLF.VPS....E.G....E....FADP...SPgtg.......................................afhRRG.PCSRCAPFKAQ.TV...........AVPL...R.C......--.........-.G...A...Q..V.W...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A1U7U5S4_CARSF/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
G1L523_AILME/133-242                   ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPG....S.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
A0A093NYS3_PYGAD/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VTVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A6G0IE32_LARCR/149-259               ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A4Z2HYF6_9TELE/53-185                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PNSG...EGqnrggasgsg.........................rkshsnkaqePFQ.SCSFCRPHRIT.QL...........TVRL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A087X407_POEFO/15-124                ......................................hsaaapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCTPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A3Q4G2A4_NEOBR/66-176                ..................................................yevpe------SSQE....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIE.....E..E...GCLR.RTIIN......R.FCYGQCN....SFY.IPR....N.K....Y....QDGN...--.............................................AFR.SCSACKPKAFS.TV...........TYTL...L.C......PG.........Q.T...P...S..T.K...R...K...R...V....Q....R....V.....K.....LCRCTT-i.................................................
A0A673TTZ0_SURSU/133-241               ..............................................hfmfrmgpa-------SQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.S....Q....H---...--.............................................PHA.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...F...P..P.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
A0A091WMK5_OPIHO/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A5J5CQB8_9PERO/62-194                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QAqnrgqasgs..........................grkghnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A3M6UCK8_9CNID/21-115                ..............................................sllanpmka----------....---.--...--...-A..LA...SVHCERKGYT.......F.PVK.....V..V...GCQE.RMVTV......N.TCIGTCL....SFS.TPT....G.S....N....YE--...--.............................................QVE.SCTCCEPTKTT.TI...........DVGL...W.C......QD.........A.S...N...P..-.-...-...-...-...-....-....-....-.....-.....-------gsfvkvrlsvh.......................................
A0A2K6A7L1_MANLE/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
L8HVJ2_9CETA/30-130                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................ALV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A182XY16_ANOST/24-137                ........................................atanrehkvhnivly----------....---.--...--...-P..NK...QSWCTTRNIS.......Q.VIT.....E..P...GCKQ.VTIDN......N.VCVGACF....SYS.IPH....T.E....P....SDPG...EI.............................................IGP.YCDSCQPSDVS.YV...........FVKV...D.C......TEn......vnM.K...N...P..Y.L...Y...K...Q...V....Q....L....I.....H.....NCTCTA-c.................................................
A0A485P4E5_LYNPA/1-102                 ....................................................msl----------....---.PL...DP...HE..VT...RERCKAVPFT.......Q.VIS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.VPG....L.D....P....T---...--.............................................PLV.LCNSCVPTRKR.WT...........PVVL...W.C......RA.........S.G...P...G..S.R...R...R...RktsT....V....L....V.....E.....GCQCS--pk................................................
CER1_CHICK/142-250                     ................................................hfmlrkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.SVA.....H..E...SCEK.VIVQN......N.LCFGKCS....SFH.VPG....P.D....D....R---...--.............................................LYT.FCSKCLPTKFS.MK...........HLDL...N.C......T-.........-.S...S...V..P.V...V...K...K...V....M....I....V.....E.....ECNCET-q.................................................
E1BN54_BOVIN/135-244                   ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SLP.FPE....A.A....Q....H---...--.............................................PHT.FCSHCLPAKFT.TR...........HLQL...N.C......T-.........-.N...L...A..M.V...I...K...V...V....M....L....V.....E.....ECQCMV-k.................................................
A0A183J3V1_9BILA/53-161                ...................................eanngdghgtmtipidvqri----------....---.--...--...-V..KE...KSWCKMKQFV.......Q.NIT.....Q..A...GCET.VQLKN......N.FCYGACF....SMG.LPD....I.V....H....N---...--.............................................QLT.ICSYCAPAAFA.RR...........RVRL...T.C......E-.........-.N...K...T..M.L...T...T...W...V....K....I....V.....R.....ICECL--gc................................................
H0W710_CAVPO/16-124                    .........................................lavsegrgreaaip----------....---.--...--...--..--...--GCHLHPFN.......V.TVRs..dpQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTIHGLR.KV...........KVQL...Q.C......T-.........-.G...S...Q..S.G...E...L...E...I....F....T....A.....R.....ACRCDM-c.................................................
L5LPB7_MYODS/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A452RJ18_URSAM/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3P9DBF0_9CICH/127-241               .................................................qkvidk------GGK-....MSL.PV...NL...KD..M-...KQTCTAVPFT.......Q.HVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FEGL...SPetg.......................................afhRRA.PCSRCAPSKAQ.TV...........TVPL...R.C......--.........-.G...A...D..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A553PQJ7_TIGCA/639-743               ..........................................avlvlsmlglayg----------....---.--...--...--..--...-DDCHLTKVI.......H.TLH.....Y..P...GCTP.RHIGS......F.ACTGKCN....SYV.QVS....G.S....K....L---...WL.............................................QER.SCMCCQESGER.EA...........IISV...E.C......KGp.......vK.G...T...S..V.Y...K...R...V...V....T....K....A....pA.....DCMC---rpc...............................................
A0A5J5CQV1_9PERO/282-392               ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIQ.....E..E...GCLS.RTILN......R.FCYGQCN....SFY.IPR....H.N....Y....QDGD...--.............................................AFQ.SCSACKPKTFS.TI...........TYTL...F.C......PG.........Q.I...P...S..T.R...K...K...R...I....Q....R....V.....K.....QCRCTT-i.................................................
A0A4W5N472_9TELE/25-141                ...............................................vvhasssk--------AE....SGH.ST...RL...GD..TD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A4W5MQQ1_9TELE/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A670IM06_PODMU/138-248               ......................................................e-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTHSLK.......Q.TIH.....E..E...GCHS.HTIIN......K.FCYGQCN....SFY.IPR....H.I....H....REEG...--.............................................SFQ.SCSFCKPKKLT.TM...........SVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A3Q7SCV0_VULVU/83-194                .............................................lhrgqevapt----------....VSL.PL...DL...QE..VV...QEMCRAVPFT.......Q.VLS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.IPS....L.D....P....A---...--.............................................PFV.LCNSCVPTRQR.WT...........PVVL...W.C......RA.........S.S...P...A..S.R...R...R...M...K....Ms.tvL....V.....E.....GCQCS--pk................................................
A0A4X2L6E6_VOMUR/24-123                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCKS.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPSQSM.WE...........IVTL...D.C......PS.........H.D...E..mP..R.V...D...K...L...V....E....K....I.....I.....HCSCQA-c.................................................
A0A671TJ31_SPAAU/36-140                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
D2A239_TRICA/126-252                   ......................................................r-KLLKSSKN-....ALF.VT...KK...EY..LQ...RDWCKTEPLI.......Q.KVK.....E..E...GCLT.RTVIN......R.FCYGQCN....SFY.IPK....N.P....K....KRHR...HIpvseete...............................dedqngpAFK.ACAFCRPSKFT.WI...........SVTL...K.C......PS.........L.M...P...P..F.R...K...K...R...I....Q....R....I.....K.....QCKCIA-a.................................................
A0A4V3S7F1_9HYME/608-708               ...............................................ggteaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P..gE..M.K...F...R...K...V....I....T....Ka...pL.....ECMC---rpc...............................................
G3UQN1_MELGA/130-191                   ................................................hfmlrkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.SVA.....H..E...NCEK.VIVQN......N.LCFGKCS....SFH.VP-....-.-....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------g.................................................
G7NUT0_MACFA/58-158                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
G3UC34_LOXAF/52-162                    .....................................................ke--VLLSSQE-....GLV.FS...EP...KY..LQ...SGWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVLN......L.LSYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A4W4HA65_ELEEL/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQA.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sT.D...S...P..R.V...D...K...L...V....E....Q....I.....L.....HCSCQS-c.................................................
A0A1V4KP94_PATFA/40-139                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
M3ZDD6_XIPMA/22-131                    ......................................hsaaapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCTPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
R0JMI9_ANAPL/49-160                    .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A093GV84_DRYPU/73-183                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.SM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A0N4VBS1_ENTVE/70-184                ......................................kealslaryeinlgsve----------....---.--...--...NM..KH...RNNCKAQQFK.......Q.RIR.....M..D...GCIT.KTITN......K.FCHGTCL....SFF.IPR....L.R....P....RKLK..lRS.............................................IFH.SCSACAPSEYD.LV...........NVKL...E.C......PE.........L.D...T...K..S.V...V...R...Q...V....Y....K....I.....K.....KCSCKS-v.................................................
CER1_XENTR/149-256                     ...............................................nflvkmng------APQN....TSH.GG...KP...QE..IM...KEACKTLPFT.......Q.NIV.....H..E...NCDR.MVIQN......N.LCFGKCI....SLH.VPN....Q.Q....D....RR--...--.............................................--N.TCAHCLPSKFT.LN...........HLAL...N.C......T-.........-.G...S...N..N.V...V...K...V...V....M....M....V.....E.....ECACEA-h.................................................
A0A3Q1G2J7_9TELE/17-124                ........................................aappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A2A4JN46_HELVI/114-231               ......................................................r-KILKSSKN-....ALV.VT...KK...DY..LK...EDWCKTEPLV.......Q.KIR.....E..P...GCLP.TTVIN......K.FCYGQCN....SFY.IPK....G.P....R....RRDN...NAdr........................................pqpAFK.SCSFCRPKKFT.WV...........TVTL...R.C......PG.........Q.N...P...P..F.R...R...K...R...I....Q....K....V.....K.....QCKCL--pv................................................
A0A3B1K2Y5_ASTMX/102-215               ..........................................rknmktgqqdger----------....VAL.PI...NP...RDlnLK...DQSCAAVPFT.......Q.RIS.....E..P...GCET.LTIHN......K.LCFGHCT....SLF.VPP....S.G....G....PVGH...--.............................................VSA.PCSRCAPSKAR.TV...........PVHL...R.C......--.........-.G...A...Q..T.R...E...K...L...V....M....M....V.....E.....ECKCET-g.................................................
F6V0D3_MONDO/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
F1PIN2_CANLF/18-122                    ............................................egwgrqaaipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnMTS.VSQCCTISGLK.KV...........KVQL...Q.C......G-.........-.G...D...Q..K.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A094LDG6_PODCR/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
G1U4Z7_RABIT/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A212C5H0_CEREH/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEE.VVVQN......N.LCFGKCG....SLP.FPE....A.A....Q....H---...--.............................................PHT.FCSHCLPAKFT.TR...........HLQL...N.C......T-.........-.G...L...A..M.V...V...K...V...V....M....L....V.....E.....ECQCM--gk................................................
S4S1R9_PETMA/55-167                    .....................................................de--VLASSQD-....ALV.VT...ER...RY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCTS.RTVIN......R.FCYGQCN....SFY.IPR....G.A....G....GPLG...VH.............................................AFQ.SCAFCKPQQVG.TF...........AVSL...D.C......PG.........R.Q...P...A..V.T...R...K...L...V....P....R....I.....K.....RCRCMS-v.................................................
A0A099ZFA2_TINGU/143-251               ................................................hfmlkkn-----AASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.GVA.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VSG....P.D....E....H---...--.............................................LHT.FCSHCLPTKFS.MK...........RLEL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCEI-q.................................................
A0A553Q0U7_9TELE/113-223               ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFS.TM...........SFTL...N.C......PE.........Q.Q...P...P..T.R...K...K...R...V....Q....R....V.....K.....QCRCVS-i.................................................
U3KKZ1_FICAL/49-160                    .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q1HL52_ANATE/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A2G9TGT6_TELCI/1-66                  ......................................................y----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.-CHGTCA....SYF.IPR....L.N....S....KKLK...-A.............................................VFK.SCAACVPRDYD.AV...........NVTL...D.C......PG.........Q.D...P...P..Q.I...T...K...S...I....V....K....I.....K.....KCECI--dl................................................
H2QFI1_PANTR/76-188                    ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VI...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.IRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKR.WA...........PVVL...W.C.....lTG.........S.S...A...S..R.R...R...V...K...Is..tM....L....I.....E.....GCHCS--pk................................................
W5PJ86_SHEEP/30-130                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIGG......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091FQ88_9AVES/71-171                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....-....-....-.....-.....-------t.................................................
L8IQZ7_9CETA/14-124                    .......................................lllavtegqsrqaaip----------....---.--...--...--..--...--GCYLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISSLR.KV...........KVQL...H.C......G-.........-.G...N...R..K.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A3P8W482_CYNSE/131-246               ..................................................qtaig-----KEDKT....MSV.PI...SL...KD..T-...KQTCTAVAFT.......Q.LVT.....A..D...GCDS.VKIQN......K.FCFGQCS....SLF.VPS....E.G....D....FAAL...GSglg.......................................tyhRRA.PCSRCAPSKAH.TV...........TVPL...H.C......--.........-.G...T...Q..I.R...E...K...R...L....L....V....V.....E.....ECKCET-g.................................................
A0A218UTK6_9PASE/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFT.......Q.GVT.....H..N...SCEK.VTVQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYT.FCSRCLPSKFS.MK...........RLDL...N.C......T-.........-.D...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCES-r.................................................
J9JXY0_ACYPI/20-128                    ........................................mafadngngvvvtar----------....---.--...--...--..-S...SDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..Q.G...E...K...K...F....R....K....V.....TtkaplECMC---rpc...............................................
A0A1S3CW54_DIACI/40-145                .............................................vlirsnssvt----------....---.--...--...-A..AS...SDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WT.............................................MER.SCLCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..E.G...E...K...K...F....R....K....V.....-.....-------itkapldcmcrpc.....................................
A0A3B3H819_ORYLA/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...N.C......PG........sE.E...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A5A9NPY3_9TELE/64-189                ......................................................h-DVLSSSRE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....L..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.L....T....SQTS...SQrsrkta................................pvtdhnsSFQ.SCAFCRPSRIT.TV...........TVRL...H.C......PG.........L.Q...P...P..Y.R...Q...R...K...V....Q....R....I.....K.....QCKCVS-v.................................................
A0A452CFL8_BALAS/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3P9A9H2_ESOLU/49-159                ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KEQE...--.............................................SFQ.SCAFCRPQRFT.TL...........TVEL...D.C......PD.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A553RPV9_9TELE/63-188                .....................................................kh-DMLSSSRE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVT.....L..E...GCLS.QTIIN......R.FCYGQCN....SFY.IPR....H.L....T....SQSS...HRnrkaas.................................tpehnsSFQ.SCAFCRPSRIT.TV...........TVRL...H.C......PG.........L.Q...P...P..Y.R...Q...R...K...V....Q....R....I.....K.....QCKCVS-v.................................................
A0A482XJR6_LAOST/17-129                ........................................mmlaesfqeeakppa----------....---.--...--...SA..VS...SDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGKCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......P-.........-.K...A...K..P.G...E...K...K...F....R....K....V.....N.....T------kapldcmcrpct......................................
G3UHA0_LOXAF/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....QCSCQA-c.................................................
A0A093LT95_FULGA/71-175                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....E------..................................................
A0A3P9DRC6_9CICH/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSS...QGqsrgqtsgs..........................grknhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A3N0XJW8_ANAGA/282-392               ......................................................d-EVLDSSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......L.MIY.....E..D...GCQP.RTIIN......R.FCYGQCN....SFY.IPR....H.V....Y....QEDS...--.............................................AFQ.SCSVCKPKSFT.TV...........TYTL...I.C......PG.........Q.I...P...S..T.K...K...K...R...V....R....R....V.....K.....QCRCTS-v.................................................
A0A667YFP1_9TELE/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........S.E...E..tP..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
H2Q1E8_PANTR/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A7RWM9_NEMVE/256-360                   ..........................................tttsrgnpfkiay----------....---.--...--...--..-A...NQQCKLSGYT.......M.EVT.....V..H...SCQP.RKISV......N.TCVGTCV....SSA.LPA....A.G....L....R---...--.............................................IEP.ACTCCQEIESH.EV...........EVGL...W.Cq...asPN.........S.A...W...T..Q.E...Y...H...V...I....K....T....A.....T.....KCACR--pc................................................
A0A2K5RME3_CEBCA/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1U7QZ41_MESAU/135-244               .............................................hrfmfrkgpa-------SQG....VIL.PI...KS...HE..VH...RETCRTVPFN.......Q.TIA.....H..E...DCEK.AVVPN......N.LCFGKCG....SIH.FPG....A.E....S....H---...--.............................................RYN.FCSHCSPTRFT.TM...........SLRL...N.C......T-.........-.G...S...T..P.V...V...K...M...V....M....Q....V.....E.....ECQCL--tk................................................
A0A2I2UVF9_FELCA/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
L5K930_PTEAL/135-244                   ................................................hhfmfrm----SPASQG....VIL.PI...KS...HE..VH...QETCRTVPFS.......Q.SIT.....H..E...DCEE.IVVQN......N.LCFGKCG....SIR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLSL...N.C......TG.........L.-...-...G..P.V...V...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
H3BGP6_LATCH/55-164                    .....................................................dd--VLDSNQA-....ALI.VT...ER...RH..VR...RDWCKSHPLV.......Q.TLH.....E..E...GCLT.RTVIN......R.FCYGQCN....SFF.IPS....Q.T....N....GAE-...--.............................................PFR.SCSFCKPRNFN.TV...........VVTF...N.C......PG.........M.S...P...P..A.K...H...R...R...I....Q....L....V.....K.....ECRCIS-i.................................................
A0A3P9Q6X6_POERE/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A5E4MHL7_9HEMI/16-125                ..............................................laflqqsps----------....---.VT...GS...DT..WQ...KPGCHKVGHT.......R.KIS.....I..P...NCVE.FHITT......N.ACRGYCE....SWA.VPS....P.A....D....TVMI...NPh..........................................qrITS.VGQCCNIMETE.DV...........EVNV...R.C......L-.........-.-...E...G..V.R...K...L...V...F....K....S....A.....L.....SCSCY--hc................................................
F7IL92_CALJA/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q1G346_9TELE/120-237               ...........................................qmwqralgkggk----------....TTL.PI...NL...KD..T-...KRTCTAVPFT.......Q.HVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPY....E.G....E....FAGL...SPgtg.......................................afqRRA.PCSRCAPFKAR.TV...........TVPL...R.C......--.........-.G...A...E..L.R...E...K...R...V....M....L....V.....E.....DCKCEM-s.................................................
A0A093QQ12_PHACA/31-125                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E...I..P.R..vD...K...L...V....E....-....-.....-.....-------kilh..............................................
A0A077ZEX6_TRITR/146-255               ..................................................kpppq--------QQ....TYV.VA...SR...DM..IG...VEHCRTIPFK.......Q.RIR.....I..D...GCLS.KTVVN......N.ICHGQCN....SFF.IPR....L.H....S....SKLR...-A.............................................LFE.SYSVCRPTQVT.TV...........TVHL...R.C......PN.........R.V...T...P..I.V...R...R...K...Y....F....K....V.....K.....QCSCMS-a.................................................
Q7QF01_ANOGA/24-137                    ........................................atanrehkvhnivly----------....---.--...--...-P..NK...QSWCTTRNIS.......Q.VIT.....E..P...GCKQ.VTIDN......N.VCVGACF....SYS.IPH....T.E....P....SDPG...EI.............................................IGP.YCDSCQPSDVS.YV...........FVKV...D.C......TEs......gnA.K...S...P..Y.L...Y...K...Q...V....Q....L....I.....H.....NCTCTA-c.................................................
A0A668AZV8_9TELE/127-245               ..............................................qramekgdh---------Gk.msMSL.PV...SL...KD..TT...KQTCSAVPFT.......Q.RVT.....A..E...GCST.VTVHN......K.LCFGQCS....SLF.VPS....G.G....E....FSGL...GTgt........................................gglHRA.PCSRCAPSKAH.TV...........SIPL...H.C......--.........-.G...A...E..V.R...Q...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A2U3XH14_LEPWE/78-189                .............................................lhhgqevapt----------....MSL.PL...DP...QE..VA...QEMCKAVPYT.......Q.VLS.....Q..P...GCTA.VHLRN......Q.LCFGYCS....SLY.IPS....S.D....P....T---...--.............................................PLV.LCNGCVPTRKR.RT...........RVVL...W.C......RA.........S.S...P...A..S.R...R...Q...MkmsT....V....L....V.....E.....GCQCS--pr................................................
A0A384CE44_URSMA/109-203               ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E...V..P.R...V...D...K...-....-....-....-.....-.....-------lveklct...........................................
GPHA2_HUMAN/16-124                     ........................................lavteawgqeavipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLK.KV...........KVQL...Q.C......V-.........-.G...S...R..R.E...E...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A151MHE7_ALLMI/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PD.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A674HQV8_TAEGU/223-333               ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K5PN94_CEBCA/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A1W4WTK5_AGRPL/19-131                ....................................kqchserehkvhnivlypd----------....---.--...--...--..-R...HSWCQTTAIK.......Q.IVA.....S..P...GYEP.VTIDN......N.VCVGACY....SYS.IPR....T.Q....P....AEPG...EL.............................................IGP.YCDSCKPADSR.CY...........HVTL...H.D......DK.........N.S...S...K..T.I...Q...K...R...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A091KIJ6_9GRUI/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A151IK56_9HYME/22-124                .............................................lygateaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P...G..E.K...K...F...R...K....M....V....T.....Ka..plDCMC---rpc...............................................
A0A2Y9IFN3_NEOSC/78-189                .............................................lhhgqevapt----------....MSL.PL...NP...QE..MA...QEMCKAVPYT.......Q.VLS.....Q..P...GCTA.VHLRN......H.LCFGYCS....SLY.VPS....S.D....P....T---...--.............................................PLV.LCNGCVPTRKR.RT...........RVVL...W.C......QA.........S.S...L...A..S.R...R...R..mKm.sT....V....L....V.....E.....GCQCS--pr................................................
A0A2K6DHT4_MACNE/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--lk................................................
A0A6J3QXQ4_TURTR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A452GGM0_9SAUR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.HTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A067R3X7_ZOONE/23-122                ................................................yvvlvda----------....---.--...--...--..--...KDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........NVSL...F.C......PK.........-.-...A...K..A.G...E...R...K...F....R....K....V.....StkaplECMC---rpc...............................................
A0A091JQR3_COLST/71-178                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...-....-....-....I.....T.....ECRCIS-i.................................................
A0A433T787_ELYCH/9-117                 .........................................rhflagllfmllps----------....---.--...--...--..TE...ASACSLHRSV.......H.TVR.....F..R...QCVL.-RVLS......F.TCRGTCD....SYS.SPN....P.A....D....LM--...-S.............................................IIR.NCNCCTETGFR.TA...........SIPL...R.C......PIp......dgE.S...G...T..InT...H...V...R...V....K....I....P.....T.....GCSCR--pc................................................
A0A556V2Y0_BAGYA/537-662               ....................................................kqe--VLLSSRE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TIN.....L..E...GCLS.QTFIN......H.FCYGQCN....SFY.IPR....H.L....A....SANG...RHgrkraa.................................ksnqaaSFQ.SCAFCKPHRIS.TL...........TVRL...H.C......PR.........L.Q...P...P..Y.R...H...R...K...I....Q....R....I.....K.....ECRCMS-v.................................................
A0A1U7TFD4_CARSF/1-111                 ..............................................msrtaytvg----------....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2K5HLH9_COLAP/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......R.FCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--pk................................................
A0A182GP82_AEDAL/21-139                .......................................ygnrehkvhnivlypd----------....---.--...--...--..-K...HSWCSTRNIS.......Q.VIS.....Y..P...GCKQ.VTIDN......N.VCVGACF....SYS.IPH....T.E....P....SDPG...EV.............................................IGP.YCDSCQPSETT.WH...........HVTL...D.C......SEnssnnndeeS.K...P...A..V.L...V...K...R...V....Q....I....I.....K.....NCSCTS-c.................................................
R4GBJ5_ANOCA/128-241                   ...........................................esnsdtvksdlg----------....TFY.IT...KR...DY..VN...QGWCKTQTLK.......Q.TIH.....E..E...GCNS.YSFIN......R.FCYGQCN....SFY.IPW....H.I....N....DERG...--.............................................VFQ.SCSFCKPKKFI.TT...........SVTL...H.C......PD.........R.L...P...P..R.M...R...K...K...I....R....Q....V.....V.....ECQCMT-i.................................................
A0A1S3NXG6_SALSA/25-141                ...............................................vvhasssk--------AE....NGH.ST...HL...GD..TD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A341AGN2_NEOAA/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2Y9LFM7_DELLE/61-160                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
G3ID48_CRIGR/4-114                     ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
H2N8S8_PONAB/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3S3P7J6_9ACAR/145-277               ............................................ffeqnadkktr----------....PVI.VG...RA...SD..IRk.rKSFCQTSSFK.......Q.KIL.....E..P...GCLP.KIVLN......N.YCYGQCN....SFY.IPT....Y.S....D....ESDT...AAeknqqqqq.............................tdgnyeeaAFK.SCAFCKPRKFR.YI...........SVRL...N.C......PS.........H.S...P...P..F.K...H...K...R...V....Q....I....I.....E.....KCRCLS-e.................................................
A0A4W2EXU2_BOBOX/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................ALV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3M6UVW1_9CNID/470-573               ...............................................afqlfqkp----------....---.--...--...-I..TS...THMCRYKRYK.......E.VIS.....V..KdgyNCRK.TRVKL......G.MCVGTCE....SYA.IPL....P.I....E....REDS..qPR.............................................FKT.SCQCCTPKDIK.EK...........TVKL...G.E......--.........-.-...G...C..E.K...S...I...V...V....S....Q....I.....R.....SCECKN-c.................................................
A0A2K6G4P9_PROCO/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TVT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVH.LPG....T.A....H....H---...--.............................................PHI.FCSHCSPTKFT.TM...........HLPL...N.C......T-.........-.G...F...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
G1KRN7_ANOCA/68-178                    .....................................................de--VLGSSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIN.....E..E...GCNS.QTIIN......R.FCYGQCN....SFY.IPR....H.V....Q....KEEG...--.............................................AFQ.SCSFCKPKKVT.TM...........LVTL...N.C......PE.........L.Q...P...P..R.K...R...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A091DE82_FUKDA/135-244               .............................................qhfmfrkgpa-------SQG....VVL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEN.VVVQN......N.LCFGKCG....SVP.FPG....A.A....P....R---...--.............................................PHL.FRSHCAPAKFT.TM...........RLRL...N.C......T-.........-.G...P...E..P.V...A...Q...V...V....M....Q....V.....E.....ECQCR--vk................................................
A0A670IBF9_PODMU/61-172                .....................................................hk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQALR.......Q.TVS.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A1I7VDG1_LOALO/64-197                ................ymrkqvksekkgkkvisspkealhqvnqevslgrlddsr----------....---.--...--...--..-P...AAHCDGQTFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A091CPP4_FUKDA/11-110                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTM.WE...........IVTL...E.C......PG.........H.E..vM...P..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A093H1T0_DRYPU/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2Y9FKN4_PHYMC/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3Q7S5C8_VULVU/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A060YKU0_ONCMY/68-178                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....EDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........Q.S...P...S..S.R...K...K...R...V....Q....R....V.....K.....TCRCAS-i.................................................
A0A553QVL2_9TELE/28-137                ..........................................vtcktenghlgdn----------....---.--...--...--..-N...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACSCEE-c.................................................
A0A2Y9DG94_TRIMA/135-244               ..............................................hyfmfrksp---------As.qgVIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VIVQN......N.LCFGKCG....SVH.PPG....A.V....Q....H---...--.............................................PHT.FCSHCLPTKFT.MM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...E...V....M....L....V.....E.....ECQCQV-k.................................................
A0A1S3F2C3_DIPOR/25-140                ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TVH.....E..E...GCTS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................SFQ.SCSFCKPKAFT.TM...........TVTL...N.C......PQ.........L.Q...P...P..T.K...K...R...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A5N5PDZ6_PANHP/30-137                ...........................................ckaesghlgdsd----------....---.--...--...--..--...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACSCEE-c.................................................
A0A444TNV9_ARMVU/41-157                .....................................tpkpskhhkvhglilnpd----------....---.--...--...--..-Q...HSWCELKEIK.......Q.IVT.....H..A...NCES.QEMAN......F.VCVGTCF....SYS.VPQ....T.E....P....EIPG...DE.............................................MLD.YCDSCQPAESY.WT...........TVVL...N.C......ED.........E.G...S...E..YqV...T...K...N...I....Q....K....I.....T.....NCSCS--pckptr............................................
A0A093BY60_9AVES/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K6GYW7_PROCO/20-124                .............................................eswgqetaip----------....---.--...--...--..--...--GCHMHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISSLK.KV...........KVQL...Q.C......V-.........-.G...N...R..R.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A665VKK0_ECHNA/64-174                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A093EYH4_GAVST/31-131                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
B5X1L3_SALSA/49-159                    ......................................................q-EILASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....TEHD...--.............................................SFR.SCAFCRPQRFT.TL...........TVEL...D.C......PD.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A556TXP9_BAGYA/30-137                ...........................................ckaesghlgdsd----------....---.--...--...--..--...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..iSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACSCEE-c.................................................
A0A1S3SB70_SALSA/68-178                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.AIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDDA...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........R.S...P...S..T.Q...K...K...R...V....Q....R....V.....K.....TCHCAS-i.................................................
A0A340XMC8_LIPVE/1-111                 ..............................................msrtaytvg----------....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A094L9E2_PODCR/31-97                 ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......-.-------....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVS-...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------i.................................................
A0A667YB09_9TELE/69-179                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...S..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A4X2K1M4_VOMUR/138-244               ..................................................lfrks-----SASQE....VIL.PI...KS...NE..VY...QETCRTVPFS.......Q.TIV.....H..D...DCEK.VVIQN......N.LCFGKCR....SLR.PSE....A.T....A....H---...--.............................................HRA.FCSHCSPTKFT.TK...........ELLL...K.C......T-.........-.G...P...N..P.V...A...K...V...V....M....I....V.....E.....ECQCKV-k.................................................
A0A6I8NJR4_ORNAN/17-131                ...........................................ammgdtdskmdr----------....---.-T...VR...TD..AD...PGQCMRHHYV.......D.SIS.....H..Pl.yKCSS.KMVLL......A.RCEGRCSq..sSRS.EPL....V.S....F....SAVL...KQ............................................pFRS.TCYCCRPQTSK.LK...........ALRL...R.C......S-.........-.G...G...M..R.L...T...A...T...Y....R....Y....I.....L.....SCHCEQ-c.................................................
H3FXB1_PRIPA/168-271                   ..........................................lgrtyqdfkgggg----------....---.--...--...--..--...-ESCQAHPFK.......Q.SIK.....H..P...GCLT.KVVVN......R.FCVGVCS....SIY.IPR....M.R....S....KKLK...-A.............................................HFE.SNSKCAPSEVD.RM...........RIAL...E.C......PG.........Q.E...Q...P..T.Q...E...K...V...I....T....I....V.....R.....ECKCQA-v.................................................
F4WSI7_ACREC/55-170                    .....................................sallsahrehkvhnivly----------....---.--...--...-P..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
NBL1_RAT/22-122                        ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A3Q1C1E5_AMPOC/28-142                ....................................sassnkasdnghphlgdad----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A3Q3BSK8_KRYMA/60-170                ......................................................d-EVLESSQE-....ALL.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..D...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.T....Y....QEGG...--.............................................VFQ.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...R...K...R...V....Q....R....V.....K.....QCRCAT-v.................................................
A0A286XYA0_CAVPO/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A4U0PJS3_9SPHI/11-111                ..............................................pimllqsnm----------....---.--...--...--..-T...LLICTSFYYN.......QnYIE.....K..Y...LCVQ.RSMTN......N.TCHGQCF...lMKK.IKA....Q.Q....E....KEHP...-Nfkvnfne...............................sdaivvfDFD.FTPLCHPHSSD.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------iiysiyttdlspkd....................................
F7HU74_CALJA/135-244                   ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..IH...WETCRTVPFS.......Q.TIT.....H..E...DCEQ.VVIQN......N.LCFGKCG....SAH.SPG....A.A....Q....H---...--.............................................SHA.FCSHCLPAKFT.MM...........HLPL...N.C......T-.........-.G...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
G5AP57_HETGA/92-201                    .............................................hhfmfrkgpa-------SQG....VVL.PI...KS...HE..VH...QETCRTVPFS.......Q.TVT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....P....R---...--.............................................PHT.FRFHCAPAKFT.TL...........HLQL...N.C......T-.........-.G...P...A..P.V...V...K...V...V....M....Q....V.....E.....ECQCKV-k.................................................
A0A3Q3N6R5_9TELE/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A0P7UZT4_SCLFO/120-230               ..........................................rramekssqgkea----------....LPL.PG...NV...KD..AS...RQSCSTVPFV.......Q.RVT.....E..A...GCDA.VAVPN......K.LCFGQCS....SLF.VPP....G.A....G....A---...--.............................................RGT.PCARCAPSKAR.YA...........TVTL...R.C......R-.........A.T...A...Q..A.R...E...K...H...V....M....L....V.....E.....ECRCEA-g.................................................
A0A6G1AXL3_CROCR/137-242               .................................................frmgpa-------SQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.AIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCLPAKFT.TM...........HLQL...N.C......T-.........-.G...L...S..P.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
GREM1_MACMU/71-181                     ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A060X370_ONCMY/51-176                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPH....L.M....G....PSSN...RGpgssrk................................khnkvqePFQ.SCSFCRPHRFT.QL...........TVQL...D.C......PG.........L.Q...P...T..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A2I3MT34_PAPAN/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--lk................................................
A0A653CYH6_CALMS/27-136                ........................................cmdprftrnskvhaa----------....---.--...--...--..SS...TDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGKCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..P.G...E...R...K...F....I....K....V.....TtkaplECMC---rpc...............................................
Q5TQL9_ANOGA/1-129                     ......................................................k--LLKSSKN-....ALL.VT...RK...EY..LK...KDWCKTEPLV.......Q.RIR.....E..E...GCLS.RTIVN......R.FCYGQCN....SFY.IPN....R.R....D....LADG...GGvggggggd............................fededltgpAFR.SCAFCKPKKFT.WM...........TVTL...R.C......PS.........L.V...P...Q..L.R...R...K...R...I....Q....R....I.....K.....QCKCIA-e.................................................
A0A673UA39_SURSU/77-189                ............................................slqrgpeaapt----------....LSL.PL...DP...HE..VA...RETCKAVPFT.......Q.VIS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.VPS....V.D....P....T---...--.............................................PLI.LCNSCVPARKR.WT...........PVVL...W.C......RA.........S.S...P...G..S.R...R...RmktS...T....V....L....V.....E.....ACQCS--pk................................................
A0A226EM91_FOLCA/25-139                ....................................vlltesrthhkvhnlalyp----------....---.--...--...--..ER...HSWCQAREIR.......Q.EIA.....H.pP...ECAP.TVIDN......M.VCLGACF....SYS.VPR....A.Q....D....YQP-...--.............................................IDP.YCDKCDKTISS.WT...........VVTL...N.Cs...reSN.........G.E...H...Y..T.L...T...R...N...V....E....L....I.....T.....NCSCV--dc................................................
A0A2I4BIG5_9TELE/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTVIN......R.FCYGQCN....SFY.IPR....H.I....R....REES...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...T.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
Q21013_CAEEL/21-119                    .............................................tcllqyctag----------....---.--...--...-V..TK...NNSCKKVGVE.......E.LID.....E..E...GCDL.MIIRI......N.RCSGHCF....SFT.FPN....P.L....T....KKY-...--.............................................-SV.HAKCCRMVEWE.ML...........ETEL...K.C......S-.........-.-...K...G..N.R...N...L...R...I....P....S....A.....T.....QCECF--dc................................................
A0A3B0K4N7_DROGU/28-141                ..................................klctaqadssvgspdndlqhl----------....---.--...--...--..--...GDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A026X0H1_OOCBI/19-134                .....................................salldahrehkvhnivly----------....---.--...--...-P..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...I..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A315WUH2_GAMAF/145-266               ......................................................q-KVMDKGEK-....VSL.PV...NL...KD..T-...KQTCTAVPFTqpslsssQ.HVT.....A..D...GCQT.VTVYN......K.LCFGQCS....SLF.VPS....E.G....E....FVDP...SPgtg.......................................afrRRA.PCSRCAPFKAQ.TV...........TVPL...R.C......--.........-.G...A...Q..V.W...E...K...K...V....M....V....V.....E.....ECKCET-g.................................................
A0A1S3M852_SALSA/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....EDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........K.S...P...S..S.R...K...K...R...V....Q....R....V.....K.....TCRCAS-i.................................................
A0A0L7KR94_9NEOP/110-224               ......................................................r-KVLKSSKN-....ALL.VT...KK...EY..LK...EDWCKTEPLV.......Q.KIR.....E..P...GCLP.ATVIN......K.FCYGQCN....SFY.IPK....G.P....R....RREDr.pQN.............................................AFK.SCSFCRPKNFT.WV...........TVTL...R.C......PG.........Q.N...P...P..F.R...R...K...R...V....Q....K....I.....K.....QCRCLS-v.................................................
T1JM76_STRMM/26-138                    .....................................gnfipkehkvhnivlypd----------....---.--...--...--..-K...HSWCKVTPIK.......Q.VIS.....H..T...GCQT.KNIDN......N.VCVGTCF....SFS.VPK....T.I....P....ETPG...DD.............................................QLH.YCDSCQSSDSS.WI...........IVSL...D.C......PD........dT.N...Q...P..K.V...E...K...S...V....E....I....I.....S.....NCSCIS-c.................................................
B4NIZ9_DROWI/28-141                    ....................................klciaqadnslapndndit----------....---.--...--...--..-H..lGDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A2Y9LW96_DELLE/77-184                ............................................rmqhgqdvaxs----------....LSL.PL...DP...QE..VA...QEMCKAVPFT.......Q.VLS.....R..L...GCMA.VYLLN......H.LCFGHCS....SFY.IX-....-.-....-....----...--.............................................PFI.LCNSCVPARMR.WA...........PVVL...W.Cwa..gsP-.........A.S...H...R..Q.V...K...M...S...T....V....R....V.....E.....GCQC---gpk...............................................
A0A151P194_ALLMI/2614-2717             ..........................................ssrlsrkgkncvl----------....---.--...-T...DE..MH...QETCWTLPFS.......Q.GIV.....H..E...NCEK.VVVQN......N.LCFGKCN....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPAKFN.LK...........RLEL...N.C......T-.........-.K...S...V..P.I...V...K...V...V....V....I....V.....E.....ECKCEI-q.................................................
A0A671X635_SPAAU/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A2K5PIY9_CEBCA/81-192                ...............................................pqrgqdea--------TA....VTL.PL...NP...QE..VT...EGMCKAVPFV.......Q.VLS.....R..P...GCSA.TRLQN......H.LCFGHCS....SLY.VPG....S.D....P....T---...--.............................................PLV.LCNSCMPTRKR.WA...........PVVL...W.C......HA........gS.S...A...P..R.Rw.vK...I...S...T....E....L....I.....E.....ECHC---gpk...............................................
A0A3Q1KB56_ANATE/65-175                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIK.....E..E...GCLT.RTIIN......R.FCYGQCN....SFF.IPR....H.I....Y....QDEN...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...Y.C......PG.........Q.T...P...R..T.R...K...K...R...V....R....R....V.....K.....QCRCTT-v.................................................
A0A0L7RCI6_9HYME/18-132                .....................................ttlhahrehkvhnivlyp----------....---.--...--...--..DK...HSWCKTTPIK.......Q.VLT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......eN.N...P...I..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A2K5F124_AOTNA/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1S3N661_SALSA/49-159                ......................................................q-EILASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....TEQD...--.............................................SFR.SCAFCRPQRFT.TL...........TVEL...D.C......PE.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A3M6UWW7_9CNID/65-172                ..................................................rhrlp-----TSKGG....ITV.PI...TP...QE..IG...QAWCKTKPIR.......Q.TIR.....K..R...GCES.KMVEN......N.MCYGQCR....SFY.IPI....R.K....G....A---...--.............................................-FE.SCSFCTPVNST.TL...........KVVL...N.C......PT.........R.K...I...K..K.V...V...K...N...V....K....I....I.....T.....ECSCRV-c.................................................
A0A482V9E3_9CUCU/16-128                .......................................laerehkvhniilype----------....---.--...--...--..-K...HSWCQTTAIQ.......Q.VVA.....S..P...GYEP.VTIDN......N.VCVGACY....SYS.IPS....T.Q....P....AEPG...EL.............................................IGP.YCDSCQPAETK.CY...........HVTL...N.A......DSk......nvE.G...P...K..T.F...Q...K...R...V....Q....I....I.....M.....NCSCMS-c.................................................
A0A2K5WIY3_MACFA/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
W5LU02_ASTMX/61-172                    ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TLH.....E..E...GCTS.LTIIN......R.FCYGQCN....SFY.IPR....H.V....R....AEEE...-G.............................................AFQ.SCSFCKPRRFT.TM...........TYTL...N.C......PD.........L.Q...P...P..T.K...K...K...R...V....Q....R....V.....K.....QCRCIS-i.................................................
A0A0N4T0M4_BRUPA/63-194                ..................rkqlksekkgkkmisspkealhqvnqevslgrlddsr----------....---.--...--...--..-P...TAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A060WN89_ONCMY/70-180                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TYTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A5N4E9L4_CAMDR/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VIVQN......N.LCFGKCG....SAR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......TG.........-.-...L...A..P.A...V...K...V...V....M....L....V.....E.....ECQCKV-q.................................................
NBL1_MOUSE/22-122                      ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A3M0L1B8_HIRRU/143-251               ................................................hfilkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFA.......Q.GVT.....H..N...SCEK.VTLQN......N.LCFGKCS....SFH.VPG....S.A....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLNL...N.C......T-.........-.D...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCET-r.................................................
A0A337SRV2_FELCA/132-241               ............................................hhfmfrtgpas--------QG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.LPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TT...........HLQL...N.C......T-.........-.G...L...S..P.V...V...K...V...V....M....L....V.....E.....ECQCKT-k.................................................
F7BL67_HORSE/14-124                    .........................................lvlavtegqgrqva----------....---.--...--...--..--...IPGCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISSLS.KV...........KVQL...Q.C......G-.........-.G...N...R..R.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A1L8FPE6_XENLA/25-123                .................................................lalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPIDSV.WD...........VVTL...E.C......PG.........N.E...E..fP..R.V...D...K...L...V....E....K....I.....L.....QCSCQA-c.................................................
A0A2A3EIY8_APICC/18-132                .....................................atlhahrehkvhnivlyp----------....---.--...--...--..DK...HSWCQTTQIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......tN.N...P...I..T.M...Q...K...K...V....Q....I....I.....T.....NCSCTS-c.................................................
S7NSC2_MYOBR/73-183                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A096NEP8_PAPAN/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A665VC11_ECHNA/47-163                ...................................................qkpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....S.G....R....KKHNk.aQE.............................................PFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A096MLY5_PAPAN/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A0D9SEG2_CHLSB/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A6A4W967_AMPAM/20-127                .........................................vaaltvaasrlalt----------....---.--...--...--..-G...ADECKLTPVV.......H.VLQ.....Y..P...GCVP.KPIPS......Y.ACVGHCT....SYV.QVS....G.S....K....L---...WQ.............................................TER.SCMCCQESGQR.EA...........SVSI...F.C......PK........aK.Q...S...DqkF.R...K...I...V...T....R....A....P.....V.....ECMC---rpc...............................................
A0A1V4KP70_PATFA/95-194                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2Y9FIJ7_PHYMC/1-111                 ..............................................msrtaytvg----------....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2Y9KAT8_ENHLU/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A2Y9P9X1_DELLE/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A0N4Y423_NIPBR/25-126                .......................................smlllvsshhtiaygv----------....---.--...--...--..--...KYHCRKVGAE.......E.IID.....E..R...GCEL.MIVRV......N.RCSGHCL....SFT.FPN....P.I....T....GKTS...--.............................................--V.HAKCCRMTDTE.WV...........NTEL...Q.C......D-.........-.-...D...G..P.R...A...L...K...I....P....S....A.....V.....QCDCF--dc................................................
A0A091W664_OPIHO/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...NCEK.VMIQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYS.FCSHCLPSKFS.MK...........RLYL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A0B2VNB0_TOXCA/59-155                ...............................................cllstgys----------....---.--...--...-A..TV...KTGCRKHGTQ.......H.VID.....E..P...GCDL.VAVNI......N.MCSGYCM....SFS.YPN....P.G....E....NSI-...--.............................................-TV.HGKCCRMVDTE.WI...........DVKV...N.C......D-.........-.-...D...G..E.R...K...M...R...I....P....S....A.....L.....ECRCF--dc................................................
A0A084VLM2_ANOSI/25-138                ........................................atanrehkvhnivly----------....---.--...--...-P..NK...QSWCTTRNIS.......Q.VIT.....E..P...GCKQ.VTIDN......N.VCVGACF....SYS.IPH....T.E....P....SDPG...EV.............................................IGP.YCDSCQPLNYT.HI...........FVKV...D.Ct...enPN.........M.K...T...P..Y.L...F...K...Q...V....E....L....I.....H.....NCSCTA-c.................................................
GREM1_CHICK/71-181                     ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A091ILT7_CALAN/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLI.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A5N5L218_PANHP/88-183                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCVS.QSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG.........S.V...E...A..P.R...V...-...-...-....-....-....-.....-.....-------enwihh............................................
K7G4T2_PELSI/44-143                    ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.A...E..iP..R.V...D...K...L...V....E....K....I.....L.....RCSCQA-c.................................................
A0A218VAQ8_9PASE/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A4W6FTP9_LATCA/63-173                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDGS...--.............................................AFE.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...N..S.R...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
A0A3Q2ZSR5_KRYMA/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..D...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...HGqnrgqasgs..........................grkshnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...Y...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A093QU10_PHACA/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
K7FXV1_PELSI/146-253                   .................................................fmfkkn-----SASEE....VVL.PI...KT...NE..MY...QETCRTLPFS.......Q.SIV.....H..E...NCEK.VVVEN......N.LCFGKCS....SFH.VPG....P.E....D....G---...--.............................................LYT.FCSHCLPIKFT.MK...........SLEL...N.C......T-.........-.M...S...V..A.V...V...K...V...V....M....I....I.....E.....ECKCEI-q.................................................
D2A4B8_TRICA/15-127                    .......................................faepqhkvhniilype----------....---.--...--...--..-K...YSWCQTTPIQ.......Q.VVA.....S..P...GYES.VTIHN......N.VCVGACY....SYS.IPS....T.Q....P....AEPG...EL.............................................LGP.YCDSCQPVETK.CY...........HVTL...H.A......DGk......ntE.G...P...K..T.F...Q...K...R...V....Q....I....I.....L.....KCSCMS-c.................................................
A0A210Q0Y3_MIZYE/86-198                ..................................................irptr------GKKN....SFV.IT...KR...QH..LK...KEWCKTQHFT.......Q.VVR.....E..P...GCLS.RTIIN......N.FCYGQCN....SFF.IPK....S.D....R....RDLK...EA.............................................AFV.SCGFCKPRAFS.TI...........RVTL...M.C......PG.........K.H...S...R..L.K...R...K...R...I....L....K....I.....K.....KCRCMA-q.................................................
D2H9I0_AILME/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2K5HJJ1_COLAP/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A4W5NI81_9TELE/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........Q.S...P...S..S.R...K...K...R...V....Q....R....V.....K.....TCRCAS-i.................................................
A0A099ZCW1_TINGU/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A091FQB8_9AVES/31-130                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A0G2JSZ3_RAT/22-122                  ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A4U5LWY2_STECR/157-270               ..................................................rkrlk-----GEQKE....SFI.LT...RN...EL.pKM...KDNCVGVKIT.......Q.RVR.....M..A...GCLT.RVVHN......R.YCHGTCT....SVF.IPR....L.R....A....KKLK...-A.............................................TFE.SCSACLPYDYD.RV...........QIRL...E.C......PD.........R.D...P...P..T.I...V...R...R...V....I....K....V.....K.....SCTCQS-q.................................................
A0A3P9NB91_POERE/12-119                ........................................saapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCTPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A2Y9HHY0_NEOSC/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A5C6PR01_9TELE/29-140                .....................................pskdgdngqtdpgnadpg----------....---.--...--...--..--...--RCMRHHFV.......E.TIT.....H..Pi.yKCNF.KMVLL......A.CCEGHCN....RTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.SCSCCRPHTSK.LK...........AVRL...R.C......T-.........-.G...G...R..R.I...T...A...T...Y....R....Y....I.....L.....TCNCEE-c.................................................
A0APK7_DROSI/28-141                    ....................................klctaqpdssvaatdndit----------....---.--...--...--..-H..lGDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A3Q1HZ58_ANATE/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QGqnrgqasgs..........................grknhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.K...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A1U7R7H3_MESAU/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A1U7T871_CARSF/134-243               .............................................hhfifrkspa-------SQG....VIL.PI...KS...HE..VH...WETCRTVPFR.......Q.MIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SAH.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TI...........HLPL...N.C......T-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCEV-k.................................................
A0A671TQN1_SPAAU/27-142                ....................................qsassnkasdnghphlgdt----------....---.--...--...--..-D...PEQCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A3S2LZM6_ORYJA/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..R.K...R...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
L9KRJ9_TUPCH/19-122                    .............................................gwgreaaipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISSLR.KV...........KVRL...Q.C......V-.........-.G...N...R..K.E...E...L...E...I....F....T....A.....K.....ACQCDM-c.................................................
A0A4W5MKK5_9TELE/168-286               ....................................ravdksdhsktmsmslpls----------....---.--...LK...DS..AN...RQSCAAVPFT.......Q.RIT.....S..E...GCDV.VTVHN......K.LCFGQCS....SLF.VPS....G.W....E....SARL...TDag.........................................ghRRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...H...V....M....V....V.....E.....ECKCES-g.................................................
Q4H3R0_CIOIN/115-236                   .......................................................HNILKTSAK-....AKT.IT...ER...KY..LK...RDWCKSQPVR.......Q.YIR....tA..D...GCKG.-ELIN......Q.FCYGQCN....SFY.IPK....D.I....E....IDER...DGei........................................etdYFR.FCAFCKPKTEE.WI...........SVRL...R.Crr..kgRK.........K.R...G...R..Y.V...I...K...R...V....K....R....V.....K.....GCTCIS-v.................................................
G3N7W2_GASAC/22-125                    ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VERL...C.S......EA.........E.K...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A3B5QBK5_XIPMA/49-159                ......................................................d-EILESSQE-....ALL.VT...ER...RY..LR...TDWCKTQMLK.......Q.TIQ.....E..E...GCLS.RTITN......R.FCYGQCN....SFY.IPR....H.T....Y....QDGG...--.............................................VFQ.ACSACRPKTFS.TI...........TLTL...F.C......PG.........Q.T...P...S..T.R...R...K...R...V....Q....R....V.....K.....QCRCV--nm................................................
A0A0B1SYL7_OESDE/3-100                 ................................................lvsshqt----------....---.--...-A...AY..AV...KYHCRKVGTE.......E.IID.....E..R...GCEL.MIVRV......N.RCSGHCL....SFT.FPN....P.I....T....GKTS...--.............................................--V.HAKCCRMTDTE.WV...........HTEL...Q.C......E-.........-.-...D...G..P.R...Q...I...K...I....P....S....A.....V.....QCDCF--dc................................................
A0A5E4D040_MARMO/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A673XFS2_SALTR/13-121                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sD.D...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A182GQ02_AEDAL/7-117                 .............................................aalvllasia----------....---.-C...GR...ET..WQ...KPGCHKVGHT.......R.KIS.....I..P...DCVE.FSITT......N.ACRGFCE....SFA.VPS....D.P....F....AVGQ...HKps.........................................qpVTS.VGQCCNIMETE.DV...........KVRV...L.C......V-.........-.-...N...G..I.R...N...L...T...F....K....S....A.....T.....NCSCY--hc................................................
A0A3Q3LCD1_9TELE/65-175                ......................................................e-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................AFQ.SCSFCKPKRFS.TM...........TFTL...T.C......PD.........Q.Q...P...P..T.K...R...K...R...I....K....R....V.....K.....QCRCIS-i.................................................
A0A5C6MWM3_9TELE/112-228               ...............................qmwqkavskgdlmpvslpaslkdg----------....---.--...--...--..--...KQSCSGVPFT.......Q.RVT.....A..A...GCST.VTVHN......K.LCFGQCS....SLF.VPS....E.A....P....LGTG...MGl..........................................lhHRG.PCSRCAPSKAR.AV...........VLPL...L.C......--.........-.G...A...R..V.Q...E...K...R...V....L....V....V.....E.....ECKCET-g.................................................
F1MNJ9_BOVIN/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................ALV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1U7SGP8_ALLSI/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3B5RDD6_XIPMA/27-144                .....................................qsassssnkagdkghqql----------....---.--...--...VD..TD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.FCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A1B8Y360_XENTR/23-122                ................................................rlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPIDSV.WD...........VVTL...E.C......PG.........N.E...E..fP..R.V...D...K...L...V....E....K....I.....L.....QCSCQA-c.................................................
A0A2K5F1A2_AOTNA/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091M0A4_CARIC/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....T.....ECRCIS-i.................................................
A0A0N1PGZ4_PAPMA/188-305               ......................................................r-KILKSSKN-....ALF.VT...KK...EY..LK...EDWCKTEPLV.......Q.KIR.....E..P...GCLP.ATVIN......K.FCYGQCN....SFY.IPK....G.P....R....RRDG...NEer........................................pppAFK.SCSFCKPKKFT.WI...........TVTL...R.C......PG.........Q.N...P...P..F.K...R...K...R...L....Q....K....V.....K.....QCKCL--pv................................................
A0A1A6GG93_NEOLE/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-x.................................................
A0A093R250_PHACA/71-175                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....E------..................................................
A0A5A9NK17_9TELE/64-174                ......................................................d-EVLDSSQE-....ALY.VT...ER...RY..LK...LDWCKTQPMK.......Q.TIK.....E..D...GCQP.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QEDS...--.............................................AFE.SCSVCKPKTFT.TV...........TYTL...F.C......PG.........Q.T...P...N..T.K...R...K...R...V....R....R....V.....K.....QCRCTA-i.................................................
A0A6A4VYL0_AMPAM/6-115                 ....................................................ptl---LQSSRR-....ARL.VT...KK...KY..LK...KDWCKTEPLI.......R.RLR.....E..P...GCRS.RRVID......R.FCYGQCN....SFY.IPR....E.S....R....RR--...-R.............................................AFK.SCPSCLPRRWE.RV...........SVLF...H.C......PG.........Q.V...P...A..R.R...R...R...T...V....K....L....V.....K.....QCRCM--pr................................................
A0A1U7UTW3_CARSF/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....REEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PD.........L.D...P...P..F.R...H...K...K...I....Q....K....V.....K.....HCRCTS-v.................................................
A0A671FMZ3_RHIFE/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3Q3NNA2_9TELE/34-137                ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A0A0B1Q7_CHAVO/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A1V9XEQ5_9ACAR/57-165                .....................................................ld--LLKTSKSP....AQV.LM...GM...DK..IR...ENFCKTQPFA.......Q.TIQ.....L..P...GCHP.KSVIN......N.FCYGQCN....SFF.IPN....H.S....M....G---...--.............................................PFR.TCGNCEATKTH.TM...........KIQL...A.C......PG.........H.V...D...G..V.Q...T...V...H...V....E....K....V.....L.....NCACIS-r.................................................
A0A2R9AS31_PANPA/16-124                ........................................lavteawgqeavipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..dgQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLK.KV...........KVQL...Q.C......V-.........-.G...S...R..R.E...E...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A4W5QEY3_9TELE/95-220                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPH....L.M....G....PSSN...QGlgssrk................................nhnkvqePFQ.SCSFCRPHRFT.QL...........TVQL...D.C......PG.........L.Q...P...T..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A5N5ML95_PANHP/143-253               ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVN.....H..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KEQE...--.............................................SFQ.SCAFCRPHRFT.TL...........TVEL...D.C......PD.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A3Q1BTP4_AMPOC/120-237               ...........................................qmwqrafgkggk----------....TTL.PI...NL...KD..T-...KQTCTAVPFT.......Q.HVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FAGL...SPgtg.......................................tfqRRG.PCSRCAPFKAH.TV...........TVPL...R.C......--.........-.G...A...E..L.R...E...K...R...V....M....L....V.....E.....DCKCET-s.................................................
A0A3P9BT67_9CICH/24-134                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A3B3HM19_ORYLA/29-142                ....................................atnkkakdnghphlgdpdp----------....---.--...--...--..--...-ERCVRHHFV.......E.TIK.....H..Pi.yKCNS.KMVLL......A.RCEGPCS....HTS.RSD....P.I....I....SFNSvlkQP.............................................FKN.SCSCCRPHTSK.LK...........AVRL...R.C......S-.........-.E...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A2U9CUC2_SCOMX/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....Y....QDGS...--.............................................AFE.SCSACKPRTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
M4ASC6_XIPMA/127-241                   ....................................................qev---MDKGGK-....VSL.PV...SL...KD..T-...KQTCTAVPFT.......Q.HVT.....A..D...GCQT.VTVYN......K.LCFGQCS....SLF.VPS....E.G....E....FVDP...SPgtg.......................................afrRRA.PCSRCAPFKAQ.TV...........TVPL...R.C......--.........-.G...A...Q..V.W...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A5F7Z6Z3_MACMU/3-115                 ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C......HT........gS.S...A...S..R.R...R...V...K...It..tA....L....I.....E.....GCHCS--lk................................................
CER1_HUMAN/135-244                     ..............................................hhfmfrktp---------As.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....Q....H---...--.............................................SHT.SCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A3Q4HYR1_NEOBR/28-143                .....................................sasssnkasdnghahlgd----------....---.--...--...--..AD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......T-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
T0MH60_CAMFR/15-124                    ........................................vlaviegqgrqaaip----------....---.--...--...--..--...--GCHLHPFN.......V.TVRs..drK..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISTLR.KV...........KVHL...H.C......G-.........-.G...D...R..R.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
F6VFY0_HORSE/25-140                    ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...R...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A1Y1MKW7_PHOPY/120-245               ......................................................r-KVLKSSKN-....ALL.VT...KK...EY..LQ...RDWCKTEPLV.......Q.KIK.....E..E...GCLT.RTVIN......R.FCYGQCN....SFY.IPK....N.P....K....KRNK...RKtlheqe................................dedqngaAFK.SCSFCKPKKFT.WI...........TVTL...K.C......PT.........L.V...P...I..F.R...K...K...R...I....Q....R....I.....K.....QCKCVA-t.................................................
A0A673CAG2_9TELE/17-124                ........................................aaapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A452GIL7_9SAUR/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KDEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A482WTG1_LAOST/25-141                .....................................fvsgntehkvhnivlypd----------....---.--...--...--..-K...HSWCKTTAIE.......Q.VIG.....H..P...GCEP.VTLRN......N.VCVGACF....SYS.IPR....T.L....P....AAPG...-D.............................................VLP.YCDSCQPSVSA.LH...........HVTL...K.CkkgeggDG.........E.E...S...E..T.M...N...K...V...V....E....V....I.....T.....NCSCMT-c.................................................
A0A195FC54_9HYME/22-124                .............................................lygateaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P...G..E.K...K...F...R...K....M....V....T.....Ka..plDCMC---rpc...............................................
A0A3Q3W2V0_MOLML/28-137                .........................................sasdnghphlgdtd----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Si.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...S..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A2K6REV4_RHIRO/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A384DSH8_URSMA/78-190                .............................................lhhgqevapt----------....VSL.PL...DP...QE..VA...HETCKAVPYT......tQ.VLS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.LPS....S.D....P....T---...--.............................................ALV.LCNSCAPTRKR.WT...........PVVL...W.C......WA.........G.S...P...A..S.R...R...RvktS...T....V....L....I.....E.....GCQCS--pk................................................
A0A091TPE8_PHALP/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....EGRCIS-i.................................................
A0A151WRJ9_9HYME/22-124                .............................................lygvteaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P...G..E.K...K...F...R...K....M....V....T.....Ka..plDCMC---rpc...............................................
W5J3I6_ANODA/6-118                     ..............................................llavmvwal----------....-LM.VA...AR...ES..WQ...KPGCHKVGHT.......R.KIS.....I..P...DCVE.FTITT......N.ACRGFCE....SFA.VPS....E.P....F....AILG...HKpp.........................................qpVTS.VGQCCNIMESE.DV...........HVRV...L.C......I-.........-.-...N...G..I.R...N...L...T...F....K....S....A.....T.....NCSCY--hc................................................
A0A3Q2VGM0_HAPBU/66-176                ..................................................yevpe------SSQE....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIE.....E..E...GCLR.RTIIN......R.FCYGQCN....SFY.IPR....N.K....Y....QDGN...--.............................................AFR.SCSACKPKAFS.TV...........TYTL...L.C......PG.........Q.T...P...S..T.K...R...K...R...V....Q....R....V.....K.....LCRCTT-i.................................................
A0A3Q4HA24_NEOBR/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSS...QGqsrgqtsgs..........................grknhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A4W4GT45_ELEEL/75-179                ....................................................nhf---MFRRKSEf..qTIM.SI...RN...NE..VH...QEKCRTLSFT.......Q.VVS.....H..E...NCET.LVLKN......N.VCFGKCH....H--.---....A.G....G....EA--...--.............................................DPA.SCHICSPRKSS.RE...........TVQL...E.C......G-.........-.N...N...T..R.V...T...S...I...V....T....V....V.....E.....DCACQ--ir................................................
A0A1S3FHY2_DIPOR/136-244               ..............................................hfmlrkgpa-------SQG....VIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIF.....H..E...DCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....P....H---...--.............................................PHT.FCSHCSPSKFT.MR...........HLQL...N.C......T-.........-.G...L...T..P.V...V...K...V...V....M....Q....V.....E.....ECQCTV-k.................................................
A0A2U3WJQ3_ODORO/25-140                ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2G8KYL4_STIJA/120-230               ......................................................d-KILKPSSE-....ELI.DS...GT...SY..LR...DDWCKAYTLR.......Q.RIE.....E..P...GCIS.RIITN......R.LCYGQCN....SFY.IPK....Q.S....N....DYNQ...--.............................................AFQ.SCSFCKPQKVA.YI...........TVTL...R.C......PG.........Q.D...P...P..I.K...T...K...R...V....K....R....I.....K.....KCRCMA-i.................................................
A0A668AG77_9TELE/25-138                .....................................assnkasdnghphlgdtd----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A3P8YB54_ESOLU/17-124                ........................................aappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........S.E...D..tP..R.V...D...K...L...V....E....R....I.....I.....HCSCQS-c.................................................
A0A4W5LFY3_9TELE/49-159                ......................................................q-EILASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....TEQE...--.............................................SFR.SCAFCRPQRFT.TL...........TVEL...D.C......PD.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A286ZPH0_PIG/135-244                 ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.AVIQN......N.LCFGKCG....SVH.FPG....T.P....Q....H---...--.............................................PHT.FCSHCLPAKFT.TM...........HLQL...N.C......T-.........-.G...L...S..P.V...V...K...V...V....M....L....V.....E.....ECQCQV-k.................................................
Q7YX42_CAEEL/221-334                   ....................................dtvfegrkhallqladpda----------....---.--...--...-L..IM...NQRCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGACA....SIF.IPR....M.H....S....KKLK...-A.............................................AFR.SCAACAPAEYD.YV...........DITL...D.C......PG.........R.T...P...P..T.A...T...K...T...I....V....K....V.....K.....SCKCKE-v.................................................
A0A0D9R9Z1_CHLSB/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A3Q2VPG8_HAPBU/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSS...QGqsrgqtsgs..........................grknhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A0N5CPP4_THECL/45-124                ...........................................tillmstamsty----------....---.--...--...SA..VI...KSGCHKHGTQ.......Y.VID.....E..P...GCDL.VAVNV......N.MCSGYCM....SFS.FVN....P.V....E....SSI-...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------tvhgrccrmvdnewvcytf...............................
A0A5N5N541_PANHP/113-223               ......................................................e-EVLESSQE-....ALL.VT...ER...RY..LK...RDWCKTQPLK.......Q.TLH.....E..E...GCVS.ITILN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPRRFT.TM...........TYTL...S.C......PD.........L.Q...P...P..T.R...K...K...R...V....Q....R....V.....K.....QCRCIS-i.................................................
A0A485NCG2_LYNPA/35-135                ........................................kdgssnhserwqhqi----------....---.--...--...--..--...-----KEPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2I0MP83_COLLI/71-173                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....-....-.....-.....-------xr................................................
A0A401S638_CHIPU/138-248               ......................................................d-EVLESSHE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKRFT.TM...........TVTL...N.C......PD.........L.Q...P...S..I.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A087QI10_APTFO/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A369S6W4_9METZ/8-109                 ...................................sititlmvmiscfypaqvta----------....---.--...--...--..--...---CGPALYQ.......D.WLK.....L..R...GCQP.RQVAL......K.ICEGWCT....SFT.RAK....S.Y....G....Y---...--.............................................STT.VCHRCEPTGFK.KI...........PITV...M.C......D-.........-.-...G...A..P.R...V...E...Y...L....R....S....V.....T.....GCSCRN-h.................................................
A0A2K6S795_SAIBB/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1U7R7D9_ALLSI/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....H....KEEG...--.............................................SFQ.SCSFCKPKKFT.AM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A0P6BIF0_9CRUS/17-130                ...........................................snaemrkpnein----------....--V.SI...RS...NR..GE...LSGCHQVGHT.......R.RVT.....I..P...DCVA.FMITT......N.ACRGYCE....SWS.VPS....S.W....E....ALLK...NPd..........................................kmITS.VGQCCNIMASE.DV...........TVRV...M.C......L-.........-.-...G...G..P.R...D...F...T...F....K....S....A.....K.....TCSCF--hc................................................
A0A498LLK2_LABRO/480-605               .....................................................kh-DMLSSSRE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....L..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.L....T....SQTS...HRsrktas.................................apdhntSFQ.SCAFCRPSRIT.TV...........TVRL...H.C......PG.........L.Q...P...P..Y.R...Q...R...K...V....Q....R....I.....K.....QCKCVS-v.................................................
A0A452E4N7_CAPHI/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A673X6K6_SALTR/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sD.D...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
J9L6M9_ACYPI/35-144                    .....................................nnytlrrhkvhnivlypd----------....---.--...--...--..-K...HSWCTSTPIK.......Q.VIS.....D..V...DCDP.VEIDN......L.VCLGACF....SYS.IPR....T.V....P....ANNV...DE.............................................VNS.YCDSCQPVNTL.WI...........PVKL...K.C......S-.........-.D...G...S..N.H...T...K...R...V....Q....L....I.....K.....ECRCSS-c.................................................
A0A2K6ECN1_MACNE/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
B4G615_DROPE/28-141                    ..................................klctaqgdnavappendithl----------....---.--...--...--..--...GDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A151I1Z7_9HYME/18-133                .....................................sallsahrehkvhnivly----------....---.--...--...-P..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A0P6CFK1_9CRUS/62-201                ......................................................r-NMLQTSPKD....ALV.VT...KR...RF..LR...KDWCQSQPLI.......Q.RIG.....Q..D...HCLS.TTVLN......R.FCYGQCN....SFF.IPK....N.Q....L....KEED...RAdqetpeghedatg...................avvsgagitgtakAFR.SCAVCQPKKTS.WV...........TVTL...K.C......PS.........L.V...P...N..I.R...R...R...R...V....L....I....I.....N.....QCRCMQ-p.................................................
A0A2K6GQA6_PROCO/56-156                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2Y9SRX7_PHYMC/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A341BRW3_NEOAA/60-160                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091DJC3_FUKDA/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....G..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3P9Q9F2_POERE/28-145                .....................................sasssssnkagdkghqql----------....---.--...--...VD..TD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.FCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
BURS_BOMMO/25-130                      ..........................................ghevqlppgtkff----------....---.--...--...--..--...CQECQMTAVI.......H.VLK.....H..R...GCKP.KAIPS......F.ACIGKCT....SYV.QVS....G.S....K....I---...WQ.............................................MER.TCNCCQESGER.EA...........TVVL...F.C......PD.........-.-...A...Q..N.E...E...K...R...F....R....K....V.....StkaplQCMC---rpc...............................................
A0A2T7NXA4_POMCA/30-138                .............................................pggatgalss----------....---.--...AR...HS..WE...RPGCHLVGHT.......R.VVR.....I..P...DCVP.FRVTT......N.ACRGFCL....SYA.IPS....P.M....E....TTSY...NPd..........................................yvITS.RAECCSIFDTL.DV...........PVQV...R.C......L-.........-.-...D...G..A.R...T...V...V...F....K....S....A.....R.....SCSCS--ic................................................
H2LF68_ORYLA/167-281                   ....................................................qkv---IDKGDK-....MTL.PV...NL...KD..T-...KQTCTAVSFE.......Q.HVT.....A..D...GCQT.VRVHN......K.LCFGQCS....SLF.VPS....E.G....E....VAEP...GPgtg.......................................afhHRA.PCTRCAPVKAR.TV...........TVPL...R.C......--.........-.G...A...G..V.R...E...K...R...V....M....V....V.....E.....ECKCET-s.................................................
A0A3Q3BKL2_HAPBU/18-121                ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....RCSCQS-c.................................................
A0A2P4SIE9_BAMTH/57-167                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
S9XFJ8_CAMFR/145-255                   ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
G3HU31_CRIGR/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...A..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A3KFI3_HUMAN/23-116                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E...V..P.R...V...D...K...-....-....-....-.....-.....-------lvekil............................................
A0A2U3ZXB3_ODORO/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2U3VA57_TURTR/187-296               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPDKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....ECQCKV-k.................................................
A0A0Q3X9S8_AMAAE/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG........nE.E...I...P..X.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2K5XLC3_MANLE/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A484DFX6_PERFV/92-195                ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........N.E...E..sP..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A2U4A0J4_TURTR/60-160                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2U3VUF2_ODORO/78-189                .............................................lhhgqevapt----------....VSL.PL...DP...QE..VA...QEMCKAVPYT.......Q.VLS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.IPS....S.D....P....T---...--.............................................PLV.LCNGCVPTRER.RT...........RVVL...W.C......RA.........S.S...P...A..S.R...R...R...MkmsA....V....L....V.....E.....GCQCS--pr................................................
A0A1U8CE76_MESAU/96-195                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
S4RPM8_PETMA/56-145                    ....................................................erq--VLASSHE-....ALF.VT...ER...RY..LR...RDWCKSQPLR.......Q.TVR.....E..R...GCVP.RTVIN......R.FCYGQCN....SFY.IPR....R.A....T....RRS-...VA.............................................SFR.ACAACRPQRFS.SL...........TVEL...S.C......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------..................................................
W4YWX0_STRPU/77-188                    ......................................................h-RVLKPSSEE....AMQ.IT...EK...QY..LR...GDWCKTQPLK.......Q.RIE.....E..P...GCIP.RTIAN......R.FCYGQCN....SFF.IPK....Q.A....A....SYNE...--.............................................AFK.SCSFCKPFRVN.HI...........TVTL...R.C......PG.........Q.N...P...P..I.K...R...K...R...V....P....R....V.....K.....RCRCMA-v.................................................
A0A0V1D794_TRIBR/153-279               ......................................srqrskqqqqqqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
A0A091H4B4_BUCRH/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KS...NE..MY...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....A.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
M7BJE0_CHEMY/89-181                    ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........N.A...E...I..P.R...V...D...K...-....-....-....-.....-.....-------llsqer............................................
A0A2K6RTP7_RHIRO/58-158                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
L8IU82_9CETA/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A402FA95_9SAUR/108-218               ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQKVN.SF...........TVEL...D.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A674G9W0_TAEGU/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
NBL1_CHICK/22-122                      ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1U7S9Z1_ALLSI/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQKVT.SF...........TVEL...E.C......PD.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3S0ZL52_ELYCH/73-179                ............................................slvllftllps----------....---.--...--...--..TE...ASACSLHRSV.......H.TVR.....F..R...QCIP.KRVLS......F.NCRGTCD....SYS.SLN....P.A....D....L---...MS.............................................IIR.NCNCCTETGFR.TA...........RIPL...R.C......PKpd.....geS.G...Y...R..N.A...H...V...R...V....K....L....P.....T.....GCSCR--pc................................................
A0A4W6FU41_LATCA/130-242               ................................................qrainkg-------DKM...tMSL.PI...NL...KD..T-...KQTCSAVPFT.......Q.RVT.....A..D...GCDT.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FTGMg.aLH.............................................RQA.PCSRCAPSKAH.TV...........AVPL...R.C......--.........-.G...A...E..V.R...E...R...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A1A6HPJ9_NEOLE/135-244               .............................................hrfmfrkgpa-------SQG....VIL.PI...KS...HE..VH...RETCRTVPFN.......Q.TIA.....H..E...DCEK.VVVPN......N.LCFGKCG....SIH.FPG....A.E....T....Y---...--.............................................PYN.FCSHCSPTKFT.TM...........HLRL...N.C......T-.........-.S...P...T..P.V...V...K...M...V....M....Q....V.....E.....ECQCVT-k.................................................
A0A3Q3B8H5_KRYMA/127-241               ....................................................qkv---VDKGEK-....VSL.PI...SL...KD..S-...KQTCTAVPFT.......Q.HVA.....A..D...GCQT.VTVHN......R.LCFGQCS....SLF.VPS....G.G....E....FVEL...SPetg.......................................afhRRA.PCSRCAPSRAR.TF...........RVPL...R.C......--.........-.G...A...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A672GDD8_SALFA/126-242               ...............................................qkaidkga-------KKA....TAL.PV...NL...KD..T-...KQTCTAVPFT.......Q.HVT.....A..D...GCET.VAVHN......R.LCFGQCS....SLF.VPS....E.G....E....FAEA...SPvag.......................................afqRRA.PCSRCAPFRAH.TA...........TVPL...R.C......--.........-.G...A...Q..V.R...L...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A4U5U2G8_COLLU/27-142                ...................................qsassnkasnnghphlgdsd----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACKCEE-c.................................................
R0L8F5_ANAPL/143-251                   ................................................hfmlrkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.GIA.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSQCMPTKFS.MK...........RLDL...N.C......T-.........-.N...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCEI-q.................................................
GREM1_RAT/71-181                       ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A5N3X537_MUNRE/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEE.VVVQN......N.LCFGKCG....SLP.FPE....A.A....Q....H---...--.............................................PHT.FCSHCLPAKFT.TR...........HLQL...N.C......T-.........-.G...L...A..M.V...V...K...V...V....M....L....V.....E.....ECQCM--gk................................................
E2R030_CANLF/117-227                   ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A1S3EZU8_DIPOR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TVH.....E..E...GCTS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................SFQ.SCSFCKPKAFT.TM...........TVTL...N.C......PQ.........L.Q...P...P..T.K...K...R...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3P8RN98_AMPPE/59-169                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A2Y9IRC8_ENHLU/48-163                ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2R9BLX9_PANPA/135-244               .................................................hqfmfr------KSPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A3N0YHD0_ANAGA/63-187                ......................................................k-HVMLSSSRE....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....L..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.L....T....SQTS...HRsrkts..................................tpdhhtSFQ.SCAFCRPSRIT.TV...........TVRL...H.C......PG.........L.Q...P...P..Y.R...Q...R...K...V....Q....R....I.....K.....QCKCVS-v.................................................
A0A1U7TJG9_CARSF/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A0V1LLZ5_9BILA/151-276               .......................................kksrqrskqqqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
L5K5U0_PTEAL/72-184                    ................................................rlqrgqe---------Ra.atMTL.PL...DP...QE..VA...QEKCKAVPFT.......Q.VLS.....R..L...GCTA.VRLRN......H.LCFGRCS....SLY.VPG....V.D....P....T---...--.............................................PLV.LCNSCVPSHRR.WA...........SVVL...W.C......RV.........-.G...S...P..A.S...H...R...R...V....KtstvL....V.....E.....ECQCSS-e.................................................
A0A4Z2JD62_9TELE/59-169                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A1U7QXB4_MESAU/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A0D9R2G4_CHLSB/75-188                ...............................................gslqrgqd---------Ev.aaVTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--lk................................................
A0A093QI74_9PASS/31-130                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.E...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A401RX13_CHIPU/103-213               .....................................................qd--VLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TIN.....E..D...GCVS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....RDQE...--.............................................SFQ.SCAFCKPQKFT.TL...........TVKL...N.C......PD.........L.Q...P...P..F.R...H...K...K...I....Q....R....V.....K.....QCKCIS-v.................................................
A0A4W2CZM4_BOBOX/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SLP.FPE....A.A....Q....H---...--.............................................PHT.FCSHCLPAKFT.TR...........HLQL...N.C......T-.........-.N...L...A..M.V...I...K...V...V....M....L....V.....E.....ECQCMV-k.................................................
A0A663EM05_AQUCH/50-161                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3L8SPH3_CHLGU/143-251               ................................................hfmlnkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFT.......Q.GVT.....H..N...SCEK.VTVQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYT.FCSRCLPSKFS.MK...........RLDL...N.C......T-.........-.D...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCES-r.................................................
E0VXD8_PEDHC/25-127                    .................................................ghhgiq----------....---.--...--...SS..LA...TDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVNL...F.C......PK.........A.-...-...K..P.G...E...R...K...F....R....K....V.....TtkaplECMC---rpc...............................................
A0A3P7DZ72_WUCBA/54-185                ..................rkqlksekkgkkmissprealhqvnqevslgrlddsr----------....---.--...--...--..-P...TAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A1S3GNT0_DIPOR/69-184                .............................................rmsqlqqgqe---------Va.paVSL.PL...DP...RE..VT...RETCKAVSFI.......Q.ILS.....R..P...GCTP.ARIRN......R.LCFGRCS....SLY.VPG....S.G....A....TP--...--.............................................-RG.LSNSCEPARRR.RV...........PVVL...W.C......RA.........G.S...P...A..W.R...R...RvkvS...T....E....L....V.....R.....DCQCV--pk................................................
A0A667ZME1_9TELE/53-184                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSVG...HSqnrgpvsgs..........................grrshnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PG.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A067QSH1_ZOONE/20-127                .............................................ilsvvsrtra----------....---.--...-R...DA..WE...RPGCHKVGHT.......R.KIS.....I..P...DCVE.FHITT......N.ACRGYCE....SWA.VPS....A.I....D....TLRV...NPh..........................................qaITS.VGQCCNIMDTE.DV...........EVQV...M.C......L-.........-.-...D...G..T.R...D...L...V...F....K....S....A.....K.....SCSCY--hc................................................
A0A0P7TKK2_SCLFO/52-162                ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LR...SDWCKTQPLR.......Q.TVA.....E..E...GCRS.RAVIN......R.FCYGQCN....SFY.IPR....H.V....R....KEQE...--.............................................AFQ.SCAFCRPYRVT.TL...........TVQL...D.C......PG.........L.Q...P...P..F.R...Y...R...K...V....Q....R....V.....K.....QCRCVS-v.................................................
A0A286XUV4_CAVPO/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
E5SJB3_TRISP/158-276                   ..............................................qrskqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.V...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
V3ZY72_LOTGI/1-111                     ....................................................irg-------SRK....AVV.VT...KK...TY..LR...KEWCKTQPLK.......Q.VIR.....E..K...GCLR.TTVIN......S.FCYGQCN....SFF.IPK....S.D....K....SDEN...PA.............................................AFM.SCGFCKPRKYR.MI...........IVTL...R.C......PG........kK.G...M...R..F.K...R...K...R...V....M....R....I.....K.....KCRCMA-v.................................................
A0A2Y9T013_PHYMC/22-119                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------igsslvleiqtwslprdgsqvrhqhvq.......................
A0A3P9NB88_POERE/21-131                .....................................lhsaaapahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCTPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A315V4E3_GAMAF/261-377               ......................................qsasssnkagdkghqql----------....---.--...--...VD..TD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.FCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A1J1ITX4_9DIPT/152-246               ...............................................cssyqiks----------....---.--...--...VA..SA...SDECSLTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGKCG....SYV.QVS....G.S....K....I---...WQ.............................................MER.SCNCCQESGER.EA...........SVSL...F.C......P-.........-.K...A...K..Q.G...E...R...K...F....R....K....V.....-.....-------stk...............................................
A0A1S3ABL9_ERIEU/65-177                ...........................................trgspgsavpvs----------....--L.PL...DP...QV..AA...WESCKAVSFT.......Q.VLS.....R..P...GCLS.TRLRN......R.VCFGHCS....SLY.VPG....S.N....P....G---...--.............................................PTV.LCNACTPVRQH.RV...........PVAL...W.C......RG.........P.G...A...S..R.R...R...R...R...V....EtsalV....I.....D.....GCRCT--pr................................................
G1LEV3_AILME/125-235                   ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3Q3FMW3_KRYMA/30-142                ......................................ssnrsgdnghphlgetd----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.SCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A0V0RI42_9BILA/18-108                ..................................cssssklawtksaggdssnnl----------....---.--...--...-N..LF...QQDCRIVAVE.......K.LIT.....I..P...GCIP.VRVQL......N.ACRGYCL....SWT.VPD....G.R....R....TV--...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------asyamccrmvereltkkllvnkr...........................
A0A093FHR5_TYTAL/143-251               ................................................hfilkkn-----SASEE....VVL.PI...KT...DE..MH...QENCRTLTFS.......Q.GIT.....H..E...NCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.D....D....R---...--.............................................FYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A218V7T4_9PASE/138-248               ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A0N0U3I1_9HYME/12-118                .............................................licllsetak----------....---.--...--...AI..IG...VDECQATPVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........-.-...A...K..P.G...E...K...K...F....R....K....VitkapL.....ECMC---rpc...............................................
A0A2Y9E9K2_TRIMA/74-190                ........................................letmqkgqevatttt----------....GFL.PL...DP...QE..VA...RETCKAMPFT.......Q.VLS.....H..P...GCTA.ARLRN......H.LCFGRCS....SFY.VPS....S.D....A....S---...--.............................................LIV.LCSSCVPTRKR.WT...........PVVL...W.C......QA.........G.S...P...A..S.R...R...RvktS...T....M....L....V.....E.....GCQCS--pk................................................
A0A340XJ47_LIPVE/60-160                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A482WCD7_9CUCU/2-96                  ...............................................nprlints----------....---.--...--...AA..ST...TDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........A.K...-...-..P.G...E...R...K...-....-....-....-.....-.....-------fikvris...........................................
A0A212DGZ5_CEREH/15-124                .........................................llvategqsrqaai----------....---.--...--...--..--...-PGCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLR.KV...........KVQL...H.C......G-.........-.G...S...R..K.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A4X2KBC7_VOMUR/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........Q.D...P...P..Y.R...H...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2Y9KJL3_ENHLU/131-240               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SIH.LPG....A.S....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.S...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
A0A662YZ58_ACIRT/3-114                 ..........................................rctasktdngnva----------....---.--...--...-E..TD...PERCMRHHFV.......D.TIS.....H..Pl.yKCNS.KMVLL......A.RCEGRCNq..tSRS.EPV....I.S....F....SSIL...KQ............................................pFRS.TCHCCRPHTSK.LK...........AVRL...R.C......T-.........-.G...G...A..R.V...T...A...T...Y....R....Y....I.....L.....SCNCEE-c.................................................
A0A1D2NDK3_ORCCI/1-89                  ....................................................mas----------....---.--...--...--..--...--------HT.......R.KVQ.....I..P...ECVE.FTITT......N.ACRGYCE....SFA.VPS....A.W....Y....RLQNn.pSQ............................................aITS.VGQCCNIMETE.DV...........TVNV...M.C......VD.........G.-...-...-..Q.K...E...L...V...F....K....S....A.....K.....SCACY--hck...............................................
A0A384C0X1_URSMA/133-242               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.MIT.....H..E...DCEK.VVVQN......N.LCFGKCG....STR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
A0A226NYR6_COLVI/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
H9J6U1_BOMMO/113-229                   ......................................................r-KILKSSKN-....ALI.VT...KK...EY..LK...EDWCKTEPLV.......Q.KIR.....E..P...GCIP.TTVIN......K.FCYGQCN....SFY.IPK....G.P....R....RRDN...SDrp.........................................qpAFK.SCSFCRPKNFT.WI...........TVTL...R.C......PG.........Q.N...P...P..F.R...R...K...R...L....Q....K....I.....K.....QCKCIS-v.................................................
A0A154P1H0_DUFNO/335-448               .....................................qkeelketpvhnivlypd----------....---.--...--...--..-K...HSWCKTTPIK.......Q.VVA.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......eN.N...P...I..T.V...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A673CW03_9TELE/130-245               ............................................qraidkgdkma----------....VSL.PV...SL...KD..T-...KQTCTAVPFT.......Q.RVT.....A..D...GCET.VTVYN......N.LCFGQCN....SLF.IPS....E.G....E....FARS...GTgm........................................gphRRT.PCSRCAPSKTH.TV...........TVPL...R.C......--.........-.G...A...E..V.R...Q...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A2K6TSH3_SAIBB/75-188                ...............................................grlqrgqd---------Kv.aaVTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VLS.....R..P...GCSA.TRLQN......H.LCFGHCS....SLY.VPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKR.WA...........PVVL...W.C......HA.........G.S...PasrR..W.V...K...I...S...T....E....L....I.....E.....ECHC---gpk...............................................
T1EKQ0_HELRO/1-105                     ......................................................k----------....---.--...--...-F..MK...TPQCKSIPMT.......M.TIR.....K..S...GCHD.VNLKV......K.YCGGMCQ....SYY.IPI....P.P....V....SRKD...RRdkk......................................verlAHK.ICSFCKPKSYK.YR...........NVEF...T.C......PN........sR.Y...G...P..K.V...Q...K...K...V....R....V....I.....D.....RCACT--nl................................................
A0A0D9SDE1_CHLSB/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
E2REL8_CANLF/132-241                   ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...F...V..P.V...V...K...V...V....M....L....V.....K.....ECQCKM-k.................................................
A0A5N4E3P2_CAMDR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A212F128_DANPL/193-310               ......................................................r-NILRSSKN-....ALL.VT...KK...EY..LK...EDWCKTEQLI.......Q.KIR.....E..P...GCLQ.ATVIN......N.FCYGQCN....SFY.IPK....G.P....R....RREG...NDer........................................pppAFK.SCSFCKPKKFT.WI...........TVTL...R.C......PG.........Q.N...P...P..F.R...R...K...R...L....Q....K....I.....K.....QCKCL--pv................................................
A0A663F2Z3_AQUCH/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.VVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..L.V...V...K...E...V....M....I....V.....E.....ECKCET-p.................................................
A0A091L581_CATAU/71-175                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....E------..................................................
S7MQA2_MYOBR/15-124                    ..........................................flvitegrgqqaa----------....---.--...--...--..--...TPGCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnVTS.ISQCCTITGLR.KV...........KVQL...H.C......G-.........-.G...G...R..R.E...E...L...E...I....F....T....A.....R.....ACQCDM-c.................................................
A0A3Q3BGA5_KRYMA/19-131                ...................................falcsaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..A...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLA.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A672IEJ7_SALFA/33-142                .........................................kagdnahphlgdad----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A2I0MUV1_COLLI/106-217               .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A091VWY9_OPIHO/71-158                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------..................................................
A0A151MUT8_ALLMI/103-213               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....H....KEEG...--.............................................SFQ.SCSFCKPKKFT.AM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A0P7UTI2_SCLFO/25-135                .......................................qgvasksevrplgdsp----------....---.--...--...--..--...-DRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....V.S....F....SSVL..kQP.............................................FKN.TCVCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACSCEE-c.................................................
A0A2P8YCI2_BLAGE/18-121                ............................................valvyvvlvga----------....---.--...--...--..--...MDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..A.G...E...R...K...F....R....K....V.....TtkaplECMC---rpc...............................................
A0A5N5K1K0_PANHP/122-234               .....................................................qr--VMQKSEQSk.evLSL.PF...NS...RD..AG...TQSCAALPFT.......Q.RIT.....E..E...GCEP.ITIHN......K.LCFGQCS....SMF.VPP....N.G....G....SSMH...-R.............................................GGP.SCSRCGPSRAR.TV...........HVPM...R.C......--.........-.G...S...Q..V.R...E...K...R...V....M....L....V.....E.....ECKCET-g.................................................
A0A2K6GQ94_PROCO/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091EUS3_CORBR/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3P4Q064_GULGU/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..D...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A485MDI0_LYNPA/132-241               ............................................hhfmfrtgpas--------QG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TR...........HLQL...N.C......T-.........-.G...L...S..P.V...V...K...V...V....M....L....V.....E.....ECQCKT-k.................................................
H3D1Y4_TETNG/3-99                      ...................................................dpgr----------....---.--...--...--..--...---CMRHHFV.......E.TIT.....H..Pi.yKCNF.KMVLL......A.CCEGHCS...rSTR.SDP....L.I....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...H.C......T-.........-.G...G...R..R.I...T...A...T...Y....R....Y....I.....L.....TCSCEE-c.................................................
A0A0V0X7F4_9BILA/151-276               .......................................kksrqrskqqqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
A0A2I0M2X5_COLLI/39-139                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A151MJ34_ALLMI/4-90                  ...................................................sfhl----------....---.--...--...--..--...---------L.......Q.VLG.....F..C...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3Q7V4K9_URSAR/78-189                .............................................lhhgqevapt----------....VSL.PL...DP...QE..VA...HETCKAVPYT.......Q.VLS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.LPS....S.D....P....T---...--.............................................ALV.LCNSCAPTRKR.WT...........PVVL...W.C......WA.........G.S...P...A..S.R...R...RvktS...T....V....L....I.....E.....GCQCS--pk................................................
A0A401T1B1_CHIPU/48-159                ...............................................kdkeaild-------SNQ....ALI.VT...ER...RN..VR...RDWCKSHPLT.......Q.TLK.....E..E...GCIS.RTVIN......R.FCYGQCN....SFY.IPS....H.E....H....GGE-...--.............................................PFR.SCSFCKPKKFN.SV...........TVTF...N.C......PS.........L.R...P...P..S.K...R...R...R...I....Q....L....V.....K.....DCRCIS-i.................................................
D2HG20_AILME/78-189                    ..............................................lhhgqevar---------T....VSL.PL...DP...QE..VA...QETCKAVPYT.......Q.VLS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.LPS....S.D....P....T---...--.............................................ALV.LCNSCAPTRKR.WT...........PVVL...W.C......RA.........G.S...P...A..S.R...R...RvkmS...T....M....L....I.....E.....GCQCS--pk................................................
A0A3P9BY68_9CICH/19-122                ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....RCSCQS-c.................................................
G5BWE1_HETGA/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..D...GCHS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2K5NYY2_CERAT/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....K.....GCHCS--lk................................................
A0A5F8GJQ6_MONDO/67-177                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCKS.KTILN......R.FCYGQCN....SFY.IPR....H.V....K....KDEE...--.............................................SFQ.SCAFCKPHRVT.SV...........LVEL...E.C......PG.........L.V...P...P..F.R...H...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A1S3GSJ8_DIPOR/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..G...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPARST.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...E...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A653DNA3_CALMS/14-128                .....................................tvycerehkvhnivlype----------....---.--...--...--..-K...HSWCQITPIQ.......Q.IVG.....S..P...GYEP.VTIDN......N.VCVGACY....SYS.IPK....T.Q....P....AEPG...EL.............................................IGP.YCDSCQPAEIK.CY...........HVNL...H.R......DE.........K.SpdlP...K..I.L...Q...K...R...V....Q....I....I.....T.....NCSCQS-c.................................................
A0A672V9Q2_STRHB/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYM.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.G...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
L8J0A0_9CETA/135-244                   ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SLP.FPE....A.A....Q....H---...--.............................................PHT.FCSHCLPAKFT.TR...........HLQL...N.C......T-.........-.N...L...A..M.V...I...K...V...V....M....L....V.....E.....ECQCMV-k.................................................
H2VAD0_TAKRU/63-173                    ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RVIIN......R.FCYGQCN....SFY.IPR....H.T....Y....QDGG...--.............................................VFQ.SCSACKPKTFS.SV...........TYTL...F.C......PG.........Q.T...P...S..T.K...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
A0A2K5PTD0_CEBCA/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..IH...WETCRTVPFS.......Q.TIT.....H..E...DCEK.VVIQN......N.LCFGKCG....SAH.SPG....A.A....Q....P---...--.............................................SRT.FCSHCLPAKFT.MM...........HLPL...N.C......T-.........-.G...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A444UM35_ACIRT/1539-1646             .......................................lvtsrgqqrypvgspg----------....---.--...ST...EL..LH...ADRAAAHSTK.......Q.SVV.....H..E...NCEK.VVLKN......S.LCFGRCS....SIH.VPR....N.E....D....HT--...--.............................................-KT.ICSYCIPTKFT.RK...........TVEL...K.C......K-.........-.G...S...V..S.V...T...K...L...V....M....L....V.....E.....ECQCEA-q.................................................
A0A3P9P206_POERE/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.L....G....PSSS...HGhsrgqasgs..........................grkghnkaqePFQ.SCSFCRPHRIT.HL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A672H643_SALFA/63-168                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..D...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....T.....-.....-------rrv...............................................
A0A1W4W3Y0_AGRPL/35-142                .........................................ftvmrnimaiegts----------....---.--...--...--..-T...ADECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCA....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..P.G...E...R...K...F....K....K....V.....T.....-------tkapldcmcrpc......................................
A0A1U7R4I1_MESAU/73-183                ..............................................qggqreaaa----------....VSL.PL...LP...QE..VL...QETCKTVAFI.......Q.VLS.....R..P...GCTA.ARVLN......R.LCFGHCS....SFY.IPS....A.G....P....T---...--.............................................PAV.LCNSCVPAQKR.QT...........SAVL...W.Cg...agHT.........A.S...R...R..P.V...R...M...P...I....T....L....V.....Q.....KCQCR--pk................................................
A0A1S3AGY2_ERIEU/65-165                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCTPAQSL.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A5A9PSN3_9TELE/51-161                ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LR...RDWCKTQPLR.......Q.TVS.....Q..E...GCKS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KEQE...--.............................................SFQ.SCAFCRPHRFT.TL...........TVEL...D.C......PD.........L.Q...P...P..L.R...Y...R...K...I....Q....R....V.....K.....QCRCMS-v.................................................
A0A3M6T8A2_9CNID/205-310               ......................................nsnkmpissgvpqvklg----------....---.--...-K...LN..IK...STWCVIHPFI.......D.RVH.....H..R...GCQS.AEINN......S.MCYGQCY....SFF.VPK....K.-....-....----...--.............................................-FV.SCSCCAPSSQE.TI...........KVRL...E.C......PG.........Q.N...P...S..F.V...I...K...K...V....K....I....V.....K.....ECACKD-c.................................................
A0A093HNS9_STRCA/142-250               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.GVA.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.D....D....R---...--.............................................LYT.FCSHCLPTKFS.MK...........RLEL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCEI-q.................................................
A0A091Q4F6_LEPDC/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFF.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A5J5ML26_MUNRE/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A671YYF7_SPAAU/47-165                ...................................................qkpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPP....S.G....S....GRKS...HNkv.........................................qePFQ.SCSFCKPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A3Q3L222_9TELE/131-242               ..................................................qrvid-----KGEKM...tMSL.PV...NL...KD..T-...KQACTAIPFT.......Q.RVT.....A..E...GCNT.VTVRN......K.LCFGQCS....SLF.VPS....D.R....E....VDTV..rGA.............................................LHR.PCSRCAPSKAH.TV...........PVPL...R.C......--.........-.G...A...E..T.R...E...R...A...V....M....V....V.....E.....ECRCEA-g.................................................
A0A151IA68_9HYME/100-215               .....................................sallsahrehkvhnivly----------....---.--...--...-P..DK...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A444UMS9_ACIRT/258-368               ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.I....K....KDQE...--.............................................SFQ.SCAFCKPQKFT.TL...........TVEL...D.C......PE.........L.Q...P...S..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A087QSG1_APTFO/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VTVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A094L8L4_ANTCR/140-248               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RFDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A0N4UI15_DRAME/65-155                ....................................................rea---LQQVNQN....MLN.LG...PG...EM..RR...ASQCEGQLFK.......Q.RIR.....M..D...GCLS.KVVIN......R.FCHGTCM....SYY.IPR....L.K....P....RRLK..lKA.............................................MFQ.SCSACQPSEYD.TV...........EVR-...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------tk................................................
A0A4V6AQ18_COLLU/128-243               ..........................................mwqratnkgektt----------....MPL.PV...NL...KD..A-...KQTCTAVPFT.......Q.RVT.....A..D...GCET.ITVHN......K.LCFGQCS....SLF.VPS....E.G....D....VAET...AAl..........................................hrHRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...A...Q..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A667YZA9_9TELE/50-160                ......................................................d-EVLESSQE-....ALH.VT...ER...RF..LK...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....REDS...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........Q.T...P...S..T.R...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
Q7PJ83_ANOGA/7-118                     ...............................................vsvmfcaf----------....-ML.VK...AR...ET..WQ...KPGCHKVGHT.......R.KIS.....I..P...DCVE.FTITT......N.ACRGFCE....SFA.VPS....A.P....F....ALVG...HKpp.........................................qpVTS.VGQCCNIMETE.DV...........RVRV...L.C......I-.........-.-...N...G..I.R...N...L...T...F....K....S....A.....T.....NCSCY--hc................................................
A0A452EWT4_CAPHI/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SLP.SPE....A.V....Q....H---...--.............................................PHT.FCSHCLPAKFT.TR...........HLEL...N.C......T-.........-.G...L...A..M.V...V...K...V...V....M....L....V.....E.....ECQCMV-k.................................................
A0A5N4AMQ5_PHOPY/22-133                ..........................................anmcmssskvktr----------....---.VA...A-...-A..NA...ADECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........A.-...-...K..P.G...E...R...K...F....R....K....V.....TtkaplECMC---rpc...............................................
A0A4C1W262_EUMVA/138-254               ......................................................r-KMLKSSRN-....ALL.VT...RK...EY..LK...EDWCKTERLV.......Q.KVR.....E..P...GCLT.ATVVN......K.FCYGQCN....SFY.IPR....G.P....R....RRDS...DErp.........................................paAFK.SCSFCRPKKVT.WV...........TVTL...R.C......PG.........Q.S...P...P..Y.R...R...K...R...L....Q....K....V.....S.....QCKC---lpa...............................................
A0A4W3JUR8_CALMI/141-249               ............................................hflvrrgsalq---------D....LIL.PM...KA...DE..MQ...QETCGTVPFS.......Q.SIT.....H..K...DCEQ.VVLQN......N.LCFGKCS....SFH.VPG....A.E....D....R---...--.............................................FYT.FCSHCLPTQFH.LI...........NIQL...K.C......K-.........-.G...G...G..V.V...G...K...V...L....M....M....V.....E.....KCKCEV-q.................................................
M3ZNN1_XIPMA/52-184                    ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.L....G....PSSS...HGhsrgqasgs..........................grkghnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A653DPP9_CALMS/14-103                ....................................ttvycerehkvhnivlype----------....---.--...--...--..-K...HSWCQITPIQ.......Q.IVG.....S..P...GYEP.VTIDN......N.VCVGACY....SYS.IPK....T.Q....P....AEPG...EL.............................................IGP.YCDSCQPAEIK.CY...........HVNL...H.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------r.................................................
Q171F9_AEDAE/20-137                    ........................................gnrehkvhnivlypd----------....---.--...--...--..-K...HSWCSTRNIS.......Q.VIS.....Y..P...GCKQ.VTIDN......N.VCVGACF....SYS.IPH....T.E....P....SDPG...EV.............................................IGP.YCDSCQPSETS.WH...........HVTL...D.C......SEnssnnndeeS.K...P...A..V.L...V...K...R...V....Q....I....I.....K.....NCSCTS-c.................................................
A0A091ISS1_CALAN/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QESCRTLPFS.......Q.SVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCLHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A2G9UWY1_TELCI/19-124                ............................................hrptfiismll----------....--I.AS...SH...QA..VV...KYHCRKVGAE.......E.IID.....E..R...GCEL.MIVRV......N.RCSGHCL....SFT.FPN....P.I....T....GKTS...--.............................................--V.HAKCCRMTDTE.WV...........HTEL...M.C......D-.........-.-...D...G..P.R...A...I...K...I....P....S....A.....V.....QCDCF--dc................................................
A0A212D3B5_CEREH/31-131                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
I3KNT3_ORENI/127-241                   .....................................................qk--IIDKGSK-....MSL.PV...NL...KD..M-...KQTCTAVPFT.......Q.HVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPS....E.G....E....FAGL...SPetg.......................................afhRRA.PCSRCAPSKAQ.TV...........TVPL...R.C......--.........-.G...A...D..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A0N4V2H7_ENTVE/27-142                .........................grsnrtkistnivllfcllarlsyadsasl----------....---.--...--...--..--...KVDCRKYGNR.......H.VIA.....E..D...GCQP.VMVQL......N.VCSGFCR....TFS.FYD....I.D....S....EK--...--.............................................VTV.IGKCCRMVENI.WV...........NVTL...N.C......S-.........-.-...D...G..H.R...V...V...R...L....P....S....A.....T.....ECRCF--dc................................................
U3J0F0_ANAPP/143-251                   ................................................hfmlrkn-----SASEE....VVL.PI...KT...NE..MH...QETCRTLPFS.......Q.GIA.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSQCMPTKFS.MK...........RLDL...N.C......T-.........-.N...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCEI-q.................................................
A0A4U5UER0_COLLU/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
B0W9J5_CULQU/4-116                     ...............................................hnivlypd----------....---.--...--...--..-K...HSWCSMQNIS.......Q.VIS.....N..P...GCKQ.VTIEN......N.VCVGACF....SYS.IPH....T.E....P....SDPG...EV.............................................IGP.YCDSCQPSETS.WH...........HVTL...D.CsegasaNGgs....ddeS.K...P...T..I.L...V...K...R...V....Q....I....I.....K.....NCSCTA-c.................................................
E9GLP7_DAPPU/22-135                    ...................................prnqpkgsisvstrsstsrg----------....---.--...--...--..-E...LSGCHQVGHT.......R.RVT.....I..P...DCVS.FMITT......N.ACRGFCE....SWS.VPS....S.W....E....ALLK...NPe..........................................kvITS.VGQCCNIMASE.DV...........TVRV...M.C......L-.........-.-...G...G..P.R...D...F...T...F....K....S....A.....K.....TCSCF--tc................................................
U3JVD6_FICAL/124-232                   ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFA.......Q.GVT.....H..N...GCEK.VIIQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.D...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCET-r.................................................
B0X0Y3_CULQU/10-117                    ..................................................fllvs----------....--V.VC...SK...ES..WQ...KPGCHKVGHT.......R.KIS.....I..P...SCVE.FTITT......N.ACRGFCE....SFA.IPS....A.P....F....AVGV...HKps.........................................qpVTS.VGQCCNIMETE.DV...........HVRV...M.C......T-.........-.-...E...G..I.R...N...L...T...F....K....S....A.....T.....NCSCY--hc................................................
A0A498MP64_LABRO/20-124                ...........................................hahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCTP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......SG........sD.E...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A3M0ISD3_HIRRU/171-270               ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.E...E..iP..R.V...D...K...L...V....E....K....I.....L.....RCSCQA-c.................................................
A0A3Q7VKD7_URSAR/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A091U592_PHORB/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A2Y9IJX2_ENHLU/21-134                ..............................................svsmsrtay---------Tv..gALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A093H7I5_STRCA/71-173                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....P....-.....-.....-------v.................................................
A0A2K6ECM3_MACNE/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1S3P4A2_SALSA/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........S.E...D..tP..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A3N0YH70_ANAGA/44-149                ..........................................phahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCTP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......SG........sD.E...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A091UD24_PHORB/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A5N5TLY6_9CRUS/42-157                .......................................kpskhhkvhglilnpd----------....---.--...--...--..-Q...HSWCELKEIK.......Q.IVT.....H..A...NCES.QEMAN......F.VCVGTCF....SYS.VPQ....T.E....P....EIPG...DE.............................................MLD.YCDSCQPAESY.WT...........TVVL...N.C......ED.........E.G...T...E.yQ.V...T...K...N...I....Q....K....I.....T.....NCSCS--pckptrk...........................................
A0A2Y9GG82_NEOSC/132-241               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....AVR.FPG....A.A....Q....H---...--.............................................PHT.SCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..S.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
A0A310SSL9_9HYME/10-115                ................................................icllset----------....---.--...AR...AI..IG...VDECQATPVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........-.-...A...K..P.G...E...K...K...F....R....K....VitkapL.....ECMC---rpc...............................................
A0A2K6ECL9_MACNE/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A383ZNZ1_BALAS/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPAKFT.TT...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....GCQCKV-k.................................................
A0A093GI18_DRYPU/31-131                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.E...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2Y9DUJ0_TRIMA/25-140                ..........................................kkkgsqgaipppd---------K....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A673ZS04_SALTR/68-178                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.AIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........Q.S...P...S..I.Q...K...K...R...V....Q....R....V.....K.....TCHCAS-i.................................................
A0A067R9Y8_ZOONE/342-409               ..........................................rrrpgrresheee----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.-------....---.--E....D.D....D....DESD...AP.............................................AFK.SCAFCKPKKAA.WI...........TVSL...N.C......PS.........M.S...P...R..L.R...K...K...R...I....L....R....I.....K.....QCKCIT-e.................................................
A0A238BYF7_9BILA/170-284               ...................................kealhqvnqevslgrlddsr----------....---.--...--...--..-P...AAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPTEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A3P6QJH7_CYLGO/28-133                ................................................kplfdgr--------NQ....ALItIK...DT...RE..--...MQKCEGAKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.FCHGTCP....SYF.IPR....M.N....G....KMLK...-A.............................................RFK.SCAACAPRDYD.AI...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....I....K....V.....-.....-------sly...............................................
A0A1S2ZMQ6_ERIEU/1-111                 ..............................................msrtaytvg----------....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
C6SUP0_PEDHC/18-123                    ..........................................tmlessycqgiwr----------....---.--...--...--..--...RPGCHKVGHT.......R.KVS.....I..P...DCVE.FHITT......N.ACRGFCE....SWS.IPS....G.M....E....TLRV...NPf..........................................qvITS.VGQCCNIMETE.DV...........DVKV...M.C......L-.........-.-...E...G..I.R...E...L...T...F....K....S....A.....K.....TCSCY--hc................................................
A0A0A0AMS3_CHAVO/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECPCIS-i.................................................
A0A3B1K9K4_ASTMX/29-137                ...........................................tckaesghlgdt----------....---.--...--...--..-D...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCSh..tSRS.DPL....I.S....F....SSVL...KQ............................................pFKS.TCFCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACGCEE-c.................................................
A0A2Y9K3Q7_ENHLU/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..D...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A091M7J6_CARIC/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
NBL1_XENTR/23-122                      ................................................rlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPIDSV.WD...........VVTL...E.C......PG.........N.E...E..fP..R.V...D...K...L...V....E....K....I.....L.....QCSCQA-c.................................................
I3NCG8_ICTTR/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A484CHJ7_PERFV/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QPqnrgqasgs..........................grkshnkaqePFQ.SCSFCRPHRIT.QL...........TVKL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....P....R....V.....K.....QCRCMS-v.................................................
W5PNA7_SHEEP/14-124                    .......................................lllavtegqsrqaaip----------....---.--...--...--..--...--GCYLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISGLR.KV...........KVQL...R.C......G-.........-.G...S...R..K.E...E...L...E...V....F....T....A.....R.....ACQCDM-c.................................................
A0A2K5RMB4_CEBCA/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A663DT65_AQUCH/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
F1S9G0_PIG/49-159                      ......................................................k-EVLASSQE-....ALV.VT...ER...RY..LR...SDWCKTQPLR.......Q.TVH.....E..E...GCHS.RTVLN......R.FCYGQCN....SFF.IPR....P.G....G....GS--...WG.............................................SFQ.SCAFCRPQRAA.AL...........LVEL...Q.C......PG.........R.D...P...P..F.H...L...R...K...I....Q....K....V.....K.....QCKCMS-v.................................................
A0A091H6M0_BUCRH/71-175                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....E------..................................................
A0A5A9PIW7_9TELE/127-237               .............................................kvtrkidggr--------EA....VAL.RI...NH...KD..MS...KQSCAAVPFT.......Q.RIT.....E..G...GCET.VTVHN......N.MCFGQCT....SMF.VPS....N.G....E....SRGQ...--.............................................RDA.HCTRCAPSKSR.FV...........VVPL...R.C......--.........-.G...T...E..L.R...E...R...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A5N4CJ16_CAMDR/49-161                ......................................................r-EVLSSSQE-....ALV.VT...ER...RY..LR...RDWCKTQRLR.......Q.TVR.....E..E...GCHS.RTVLN......H.FCYGQCN....SFY.IPR....P.G....G....EGEG...SG.............................................SFQ.SCAFCRPQRAA.AL...........LVEL...Q.C......PS.........R.D...P...P..V.R...L...R...K...I....Q....K....V.....K.....QCRCMS-v.................................................
V9LCQ3_CALMI/29-129                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...SCES.KSIEN......R.ACLGQCF....SYS.VPN....T.F....P....QSTD...--.............................................SLV.HCDSCMPLQSM.WE...........IVQL...E.C......PG.........N.E...E..mP..R.V...D...K...L...V....E....K....I.....V.....QCSCQA-c.................................................
R7TDN8_CAPTE/59-123                    .........................................rplprtlarhyara----------....---.--...--...--..RA...ASRCQAVPYE.......E.VVE.....I..P...GCVP.RRVQL......R.ACIGLCP....SLY.LE-....-.-....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------vagdgglletn.......................................
W5NA82_LEPOC/151-262                   ......................................................d-EILDADKVV....ALF.VT...ER...RF..VR...RDWCESRPLV.......H.TVR.....V..Q...GCLS.RAVIV......R.FCYGQCN....SFY.IPG....V.G....G....DGGG...--.............................................AFR.SCSYCQPRQLG.TL...........AVTL...T.C......PT.........L.R...P...P..T.R...L...Q...R...L....T....V....V.....R.....ECRCTS-i.................................................
L5KAF3_PTEAL/4-113                     .......................................tdsktdssfmmdsdpr----------....---.--...--...--..--...--RCMRHHYV.......D.SIS.....H..Pl.yKCSS.KMVLL......A.RCEGQCSq..aSRS.EPL....V.S....F....SAVL..kQP.............................................FRS.SCHCCRPQTSK.LK...........ALRL...R.C......S-.........-.G...G...M..R.L...T...A...T...Y....R....Y....I.....L.....SCLCEE-c.................................................
H0WFU0_OTOGA/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3Q1ARX7_AMPOC/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........sE.D...S...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A485NA03_LYNPA/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A1U7S9L2_ALLSI/103-210               .................................................ftlqkn-----SASEE....VVL.PI...KT...DE..MH...QETCWTLPFS.......Q.GIV.....H..E...NCEK.AVVQN......N.LCFGKCN....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPAKFN.LK...........RLEL...N.C......T-.........-.K...S...V..P.I...V...K...V...V....V....I....V.....E.....ECKCEI-q.................................................
A0A0V1ABN5_9BILA/153-279               ......................................srqrskqqqqqqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....KCACMA-v.................................................
A0A337SGF9_FELCA/77-189                ...............................................slqqgqea-------APT....MSL.PL...DP...HE..VT...RERCEAVPFT.......Q.VIS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.VPG....L.D....P....T---...--.............................................PLV.LCNSCVPTRKR.WA...........PVVL...W.C......RA.........S.G...P...G..S.R...R...RmktS...T....V....L....V.....E.....GCQCS--pk................................................
A0A3P8UJ15_CYNSE/20-124                ...........................................lahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..A...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........nE.E...A...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A3P4RSP7_GULGU/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
G1TUM4_RABIT/127-237                   ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A1V9XK96_9ACAR/10-101                ...............................................llqslilg----------....---.--...KA...EI..RA...EESCQLKPVI.......H.IIK.....E..P...GCQP.KPVPS......F.ACHGTCA....SYV.QVS....G.S....K....Y---...WQ.............................................VER.SCMCCQEVGER.EA...........TRRV...Y.C......PN.........Q.T...P...K..Y.K...K...-...-...-....-....-....-.....-.....-------vs................................................
A0A5A9NTN7_9TELE/83-193                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCAS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.R...K...K...R...V....Q....R....V.....K.....QCRCVS-i.................................................
A0A3P7I6Y0_STRVU/1-48                  .................................................mngkml----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.-------....---.---....-.-....-....----...KA.............................................KFK.SCAACAPRDYD.AV...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....I....-....-.....-.....-------kqaev.............................................
G3VCY2_SARHA/24-123                    ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCKS.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPSQSM.WE...........IVTL...D.C......PS.........H.D...E..mP..R.V...D...K...L...V....E....K....I.....V.....HCSCQA-c.................................................
A0A0T6AY08_9SCAR/16-129                ......................................iiadrehkvhnivlype----------....---.--...--...--..-R...HSWCQTTPIK.......Q.VVA.....L..P...GYES.LTIDN......N.VCVGACY....SYS.IPR....T.Q....P....AEPG...EL.............................................IGP.YCDSCQPVDTR.CY...........HVNL...K.A......DEk......neD.G...P...R..T.I...Q...K...R...V....Q....I....I.....T.....NCTCLS-c.................................................
A0A673UC07_SURSU/131-241               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A0K0FND7_STRVS/80-195                ...............................krihkkrkgkfqvsfegisslpqy----------....---.--...--...--..--...ETICKAEDIN.......V.KVS.....F..K...NCIS.QELIS......K.YCHGTCS....SIF.IPQ....M.R....P....HKMK...-A.............................................SFQ.SVSSCVPDDHQ.II...........KIRL...E.C......PN.........Q.V...P...D..H.V...Y...R...K...I....V....K....I.....N.....SCSCKQ-f.................................................
A0A182GFW7_AEDAL/104-256               ......................................................d-KLLKSSKN-....ALV.VT...RK...EY..LK...KDWCKTEPLV.......Q.RIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPK....S.P....K....RRRH...GGgggggggrnghghgggghgh.....hggrarevdldfededltgpAFR.SCAFCKPKKFT.WI...........TVTL...R.C......PS.........L.V...P...Q..L.R...R...K...R...I....Q....R....I.....K.....QCKCIA-e.................................................
A0A452RY82_URSAM/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2A2LS04_9BILA/10-85                 .............................................cfstacagli----------....---.--...--...--..--...-KECRVVGAE.......E.LID.....E..E...GCDL.SIVRV......N.RCSGQCL....SFS.FPN....P.N....T....RKNT...-V.............................................HAK.CCR--------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------mvdsewvsheslha....................................
A0A2B4RDT1_STYPI/22-124                ............................................wavnfkvstqr----------....---.-V...TQ...RV..HH...KEVCKPWSVK.......V.AVR.....V..V...DCQT.RMVSL......N.QCAGTCL....SEH.---....-.S....L....N---...--.............................................-EE.SCKCCKPVKKS.VV...........NVPL...H.C......QDs.......sG.N...P...S..H.Y...T...H...Q...M....E....Q....H.....E.....ECSCL--pc................................................
A0A091QVN0_MERNU/143-251               ................................................hfmlkkn-----SASEG....IIL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCDK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.VK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A401T2R0_CHIPU/237-337               .............................................iekgrgvtee----------....IVL.PL...SE...QE..AS...RSSCRAVPFT.......Q.SIS.....H..L...NCKA.FNIQN......Q.LCFGQCS....SFF.IPG....A.E....Q....R---...--.............................................LNQ.SCSRCFPSQLR.KI...........VVSL...E.C......E-.........-.G...V...L..V.V...S...R...N...I....T....V....V.....E.....-------e.................................................
A0A3Q1HHL6_ANATE/128-232               ............................................qraidkgdkma----------....MSL.PV...SL...KD..T-...KQTCSAVPFT.......Q.RVT.....A..D...GCET.VTVHN......K.LCFGQCS....SLF.VPS....E.G....D....DAGF...--.............................................-GP.AA---GALHPH.TV...........TVPL...R.C......G-.........-.-...G...A..I.R...E...R...R...V....M....V....V.....E.....ECKCE--vg................................................
A0A0Q3MBA7_AMAAE/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QQNCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.G...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A3P6SEH4_LITSI/52-166                ..................................kealqrvnqevslgrlddsrp----------....---.--...--...--..--...VAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A3Q4G2R8_NEOBR/62-172                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A091EC65_FUKDA/178-288               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..D...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A340XWZ7_LIPVE/135-244               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPDKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....ECQCKV-k.................................................
G1NQZ5_MELGA/71-181                    ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
G3TDR2_LOXAF/135-244                   ..............................................hyfmfrksp---------As.qgVIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIS.....H..E...DCEK.VVVQN......N.LCFGKCG....SVH.PPG....A.A....Q....H---...--.............................................SHT.FCSHCLPTKFT.MM...........HLEL...N.C......T-.........-.G...L...A..P.V...A...K...E...V....M....L....V.....E.....ECQCQV-k.................................................
A0A091QDW7_MERNU/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....R.....ECRCIS-i.................................................
A0A0Q3UQZ7_AMAAE/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A093NLI9_PYGAD/71-163                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...-...-..-.-...-...-...-...-....-....-....-.....-.....-------p.................................................
A0A5N4DAT7_CAMDR/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A158NKI9_ATTCE/22-124                .............................................lygateaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....CGK-...--.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P...G..E.K...K...F...R...K....M....V....T.....Ka..plDCMC---rpc...............................................
A0A0P7THY8_SCLFO/24-124                ...............................................nrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........nE.Q...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A3Q1IMG2_ANATE/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....K....R....V.....K.....QCRCIS-i.................................................
A0A6R5ILE7_AEDAE/16-122                ......................................sctatrnkkkitwppla----------....---.-D...DI...QH..YT...ADDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......P-.........-.K...A...K..N.G...E...K...K...F....K....K....V.....-.....-------wnp...............................................
A0A3Q3CUX8_HAPBU/24-134                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A2K5LNC8_CERAT/28-123                ....................................................fpd----------....---.--...--...--..-K...SAWCEAFFFT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SFF.FPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A088AMF5_APIME/18-132                .....................................atlhahrehkvhnivlyp----------....---.--...--...--..DK...HSWCQTTQIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......tN.N...P...I..T.M...Q...K...K...V....Q....I....I.....T.....NCSCTS-c.................................................
A0A091ENS9_CORBR/143-251               ................................................hfmlkkn-----SDSEE....VVL.PI...KT...NE..MH...QENCRTLPFA.......Q.GVT.....H..N...SCEK.VTVQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.D...S...V..P.V...I...K...E...I....M....I....V.....E.....ECKCET-r.................................................
A0A091GQK3_9AVES/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
G3H6M6_CRIGR/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEED...--.............................................SFQ.SCAFCKPQRVT.SV...........IVEL...E.C......PG.........L.D...P...P..F.R...I...K...K...I....Q....K....V.....K.....HCRCMS-v.................................................
A0A091I1B2_CALAN/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A6A5EPS6_PERFL/164-276               .....................................ssnkasdnghphlgdsdp----------....---.--...--...--..--...-QRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......S-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A182E1R6_ONCOC/92-213                ..............................kkvvsspkealqqvnqevslgrldd----------....---.--...--...-S..RP...AAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPTEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A091RDN0_9GRUI/50-161                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A4D9EWI3_9SAUR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.HTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A3Q7WIZ1_URSAR/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
H2NMP6_PONAB/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A0N4YF27_NIPBR/7-80                  ...............................................skspllli----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.YCHGTCA....SYF.IPR....L.N....S....KKLK...-A.............................................VFK.SCAACIPRDYD.AV...........NVTL...D.C......PG.........Q.D...P...P..Q.I...T...K...S...I....V....K....V.....R.....-------ivcspdf...........................................
A0A5N5LAW0_PANHP/76-186                ......................................................q-EVLDSSQE-....ALH.VT...ER...HY..LK...RDWCKTQPLK.......Q.TLQ.....E..E...GCIS.RSIIN......S.FCYGQCN....SFY.IPR....H.V....Y....QEES...--.............................................AFQ.SCSFCKPKTFT.IV...........TYTL...I.C......PS.........Q.I...P...R..I.R...R...K...R...V....R....R....V.....K.....QCRCTS-i.................................................
E0VGW1_PEDHC/11-117                    ...............................................hnivlypd----------....---.--...--...--..-K...HSWCKTTEIK.......Q.IVA.....H..P...GCSS.IEIDN......N.VCVGACF....SYS.IPR....T.I....P....SSPG...EV.............................................IIP.YCDSCQPVEYE.WR...........EVTL...T.C......SDes....eedE.G...Q...T..E.M...T...K...R...V....Q....V....I.....T.....NCSCTT-c.................................................
A0A673C2Q3_9TELE/52-125                .......................................................----------....---.--...--...--..--...----------.......-.---.....-..-...-CVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A0V0YAD1_TRIPS/160-277               ...............................................khhqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....ARL-...VA.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMS-v.................................................
A0A2K5LNE2_CERAT/63-158                ....................................................fpd----------....---.--...--...--..-K...SAWCEAFFFT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SFF.FPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3Q3VUG0_MOLML/56-166                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A093HGS7_GAVST/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A3KFI2_HUMAN/23-109                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E...V..P.-...-...-...-...-....-....-....-.....-.....-------rvd...............................................
A0A3Q3XMY7_MOLML/13-125                ...................................falcsaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........nE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A2K5J2N2_COLAP/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A093IAS7_FULGA/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
H0YXK3_TAEGU/53-168                    ......................................................n-NTMNQAKHG....GRH.IQ...QA...PD..LNd.aAFSCREVRTT.......R.FLT.....D..G...PCRSlKPVKE......L.LCSGQCE...pSHL.LPN....S.I....G....RGKW...WR.............................................QGA.LDFRCIPAHSR.TQ...........RVPM...A.C......P-.........-.Q...Q...E..T.R...T...Y...K...F....R....A....A.....T.....SCKCKR-y.................................................
A0A087XSD8_POEFO/27-144                .....................................qsassssnkagdkghqql----------....---.--...--...VD..TD...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.FCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A498LK72_LABRO/472-582               ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....Q..E...GCKS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....R....KEQE...--.............................................SFQ.SCAFCRPHRFT.SL...........TVEL...E.C......PD.........L.Q...P...A..V.R...Y...R...K...I....Q....R....V.....K.....QCRCMS-v.................................................
A0A6G0YH65_APHCR/34-143                .....................................tnstlrrhkvhnivlypd----------....---.--...--...--..-K...HSWCTSTPIK.......Q.VIS.....D..V...DCDP.VEIDN......L.VCLGACF....SYS.IPR....T.V....P....ANNG...DE.............................................VNS.YCDSCQPVNTL.WI...........PVKL...K.C......N-.........-.D...G...S..N.H...T...K...R...V....Q....L....I.....K.....ECRCSS-c.................................................
A0A087YKH9_POEFO/52-165                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.L....G....PSSS...HE.............................................PFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A226NGK9_CALSU/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
W5JVV4_ANODA/28-141                    .......................................tianrehkvhnivlyp----------....---.--...--...--..NK...QSWCTTRNIS.......Q.VIT.....E..P...GCKQ.VTIDN......N.VCVGACF....SYS.IPH....T.E....P....SDPG...EI.............................................IGP.YCDSCQPSDVS.YK...........RVKV...D.Ct...ehPS.........M.K...T...P..Y.I...Y...K...H...I....Q....L....I.....H.....NCSCTA-c.................................................
A0A3Q3MA22_9TELE/51-182                ...................................................qkpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QSrgqasgsg............................rknhnkgqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A016UDK1_9BILA/100-208               ................................................kplldgr-------NQA....LIT.IK...DT...RE..M-...-QRCEGSKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.FCHGTCP....SYF.IPR....M.N....S....KILK...-A.............................................KFK.SCAACAPRDYD.AV...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....V....K....V.....R.....K------gssk..............................................
A0A6G0UXC1_9BILA/785-893               .........................................kfnkktmtsdmsgr----------....---.--...KN...LS..TN...PNGCMASPFS.......Q.LVH.....V..P...GCET.KFVLN......R.FCHGTCS....SFY.VPQ....L.R....S....KKLK...-A.............................................NFE.NFTVCRPAEVE.HV...........QVKL...E.C......E-.........-.-...E...G..Q.I...T...R...E...I....T....R....I.....K.....RCACVE-h.................................................
A0A3Q0E7H8_CARSF/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A151N3J3_ALLMI/203-308               ........................................tlkvppetltvstpp----------....---.--...--...--..-R...PEYCTELEYE.......E.LIT.....Y..K...GCAT.-NVTL......I.RCEGMCQ....STA.KLN....A.A....T....M---...-T.............................................VHR.ECSCCVPLTQH.RK...........ELKL...P.C......PD.........-.P...D...N..P.G...K...R...L...V....M....D....I.....Ti..fgGCTCS--yd................................................
A0A151JB20_9HYME/22-124                .............................................lygateaivg----------....---.--...--...--..--...VDECQATRVI.......H.FLQ.....Y..P...GCVP.KPIPS......Y.ACRGRCS....SYL.QVS....G.S....K....M---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PR.........A.K...P...G..E.K...K...F...R...K....M....V....T.....Ka..plDCMC---rpc...............................................
A0A3Q3AYA9_CHICK/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
W5MMX0_LEPOC/130-235                   ekgdsaketlalpvnlkepskqscaavpftqqnlrqfiltnglqqwsyhrntxgg----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.-------....---.---....-.-....-....EAAG..tGP.............................................LSA.ACSRCGPAKSR.LV...........LVPL...R.C......LG.........-.A...V...A..H.R...E...R...R...V....L....Q....V.....E.....ECRCET-r.................................................
DAND5_HUMAN/76-188                     ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VI...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.IRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKR.WA...........PVVL...W.C.....lTG.........S.S...A...S..R.R...R...V...K...Is..tM....L....I.....E.....GCHCS--pk................................................
A0A401RR94_CHIPU/2-89                  ...................................................stik----------....---.--...--...--..--...--TCSTGVKN.......V.KLT.....E..G...SCSG.-QVNV......T.VCEDKCS....---.-PN....T.Q....N....NPDM...DR.............................................KIV.ECGYCVPKNTK.FT...........NVTL...S.C......D-.........-.D...G...S..T.T...I...Y...T...I....I....E....P.....V.....SCQCK--ls................................................
C3YH06_BRAFL/30-140                    ......................................................r-EILKSSRR-....ALV.VT...ER...KY..LK...QDWCKTQPLR.......Q.TVR.....A..K...GCLS.RTVIN......R.FCYGQCN....SFY.IPK....H.V....R....KDAE...--.............................................SFQ.SCAFCKPHRYS.MI...........TVTL...R.C......PS.........L.T...P...N..F.K...R...K...R...I....Q....R....V.....K.....KCKCMS-v.................................................
A0RZD3_TRICA/21-130                    ........................................cldprlnskiqvsga----------....---.--...--...--..ST...TDECQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..P.G...E...R...K...F....I....K....V.....TtkaplECMC---rpc...............................................
A0A672VFC2_STRHB/48-159                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
U3K7P6_FICAL/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.E...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2K5US66_MACFA/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A5C6PIN7_9TELE/52-184                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSA...QAqsrgqalgs..........................rrkshnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.K...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
R7TQD0_CAPTE/3-110                     ............................................asgsqsiapsd----------....---.--...--...--..-S...RETCRLRRII.......Y.RID.....Y..E...GCVP.RRLLS......F.ACQGQCH....SYA.QLS....G.T....E....G---...VR.............................................LER.QCSCCQETRSV.TR...........QVTI...R.Cld.pddPG.........A.G...P..tR..S.M...V...M...R...V....M....L....P.....T.....RCMCR--pc................................................
A0A091D7D5_FUKDA/49-160                ..................................ellstlsprvsslvtaptvss----------....---.--...--...--..-A...PELCSVREQE.......Q.EIT.....H..Q...GCTA.-NVTL......T.HCEGTCA....SST.SFN....I.T....T....QQ--...--.............................................LDV.HCSCCWPLSSY.MQ...........ELLL...P.Cq....dPS.........A.P...S...Q..L.L...T...L...T...V....Q....V....V.....H.....SCVCAH-q.................................................
A0A6A5ELV1_PERFL/1019-1129             ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.AM...........TYTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A433T0R7_ELYCH/30-141                ................................eldatltvinqgeslpfeprcsl----------....---.--...--...--..--...-------HVR.......R.QIMe..dpR..T...GCKTdEPVDI......H.YCMGSCG...rSYS.IPQ....V.V....S....SASS...SS.............................................LNQ.TCSCCTGGMKK.LR...........TVTL...K.C......P-.........-.T...G...D..N.Q...T...G...F...Y....F....L....L.....G.....GCRCR--pc................................................
A0A553PZC0_9TELE/108-220               ...............................................qkamqksa-----RSKEA....VAL.RA...NP...KE..MS...KQSCAAVPFS.......Q.HIT.....E..D...GCEM.VTVQN......K.LCFGQCS....SMF.VPS....S.R....D....LHDG...-H.............................................QKV.SCTRCGPSRSR.TF...........LVHL...R.C......--.........-.G...T...E..T.R...E...K...S...V....M....L....V.....E.....ECKCET-s.................................................
A0A1S3AJM3_ERIEU/137-246               ................................................hhfmfrm----SPASQG....VIL.PI...KS...HE..VH...QETCRTVPFS.......Q.AVT.....H..E...DCEK.VIVQN......N.LCFGKCG....SVN.FPG....A.A....Q....Q---...--.............................................HQT.FCSHCLPTKFT.KM...........HLPL...N.C......T-.........-.D...F...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
BURS_ANOGA/23-128                      .............................................aqkdsedggs----------....---.--...--...-H..YS...SDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..N.G...E...K...K...F....R....K....V.....StkaplECMC---rpc...............................................
A0A091T6A6_PHALP/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
G3T8B8_LOXAF/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2K6MMY5_RHIBE/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......R.FCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--pk................................................
A0A151X5V5_9HYME/100-209               .........................................dvyaevhnivlypd----------....---.--...--...--..-K...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVTL...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
V8P7J1_OPHHA/114-224                   ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIQ.....E..E...GCRS.QTIIN......R.FCYGQCN....SFY.IPR....H.I....H....REEG...--.............................................SFQ.SCSFCKPKKFT.TM...........VVTL...S.C......PE.........M.Q...P...P..I.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
DAND5_MOUSE/76-184                     .............................................gqrvaagvpl----------....---.PL...AP...QE..VL...QETCKALSFV.......Q.VIS.....R..P...GCTS.ARVLN......H.LCFGRCS....SFY.IPS....S.D....P....T---...--.............................................PVV.FCNSCVPARKR.WT...........SVTL...W.C.....gAG.........Q.L...A...S..P.R...R...V...R...I....St..vL....V.....Q.....KCQCR--pk................................................
B7PJB3_IXOSC/14-118                    ..........................................swlilavlaasmg----------....---.--...--...--..-P...EESCQLRPVI.......H.VLK.....Q..P...GCQP.KPIPS......F.ACQGSCS....SYV.QVS....G.S....R....Y---...WQ.............................................VER.SCMCCQEMGER.EA...........TKAV...F.C......PK.........GpG...P...K..F.R...K...L...I...T....R....A....P.....V.....ECMCR--pc................................................
A0A674BSK6_SALTR/54-164                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TYTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A2K6EYN8_PROCO/70-184                ..................................................tdtlq-----RRQEVa.taLSL.PL...DP...QE..AT...QEMCKAVPFV.......Q.VLS.....R..P...GCTA.ARLRN......H.LCFGRCS....SLY.VPS....S.D....A....T---...--.............................................PIV.LCNSCGPSRKR.WA...........PVVL...W.C......RT.........S.S...P...A..T.R...RrvkR...S...T....M....L....V.....E.....GCQCS--pk................................................
A0A0P7V8E5_SCLFO/49-159                .....................................................qd--VLASSQE-....ALV.VT...ER...KY..LR...SDWCKTQPLR.......Q.MVT.....E..E...GCRS.RAIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEQE...--.............................................AFQ.SCAFCRPHKFT.TL...........TVEL...N.C......PG.........M.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A4W6EHN1_LATCA/26-142                ...................................vqsassnkasdnthphlgds----------....---.--...--...--..-D...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
A0A341D821_NEOAA/77-184                ............................................rmqhgqdvaxs----------....LSL.PL...DP...QE..VA...QEMCKAVSFT.......Q.VLS.....R..L...GCMA.VYLLN......H.LCFGHCS....SFY.IX-....-.-....-....----...--.............................................PFI.LCNSCVPARTR.WA...........PVVL...W.R.....wAGs.......pA.S...R...R..Q.V...K...M...S...A....V....R....V.....E.....GCQC---gpe...............................................
A0A673ZD61_SALTR/16-124                .......................................saappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG.........S.E...D..tP..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A401PCC5_SCYTO/76-186                ..................................................kedvl----DS-NHA....ALP.VT...ER...RN..VR...RDWCKSHPLI.......Q.TLK.....E..D...GCIS.RTVIN......R.FCYGQCN....SFY.IPS....H.E....H....GGE-...--.............................................PFR.SCSFCKPKKFN.AV...........TVTF...N.C......PR.........L.R...P...P..S.K...R...R...R...I....Q....L....V.....K.....ECRCIS-i.................................................
G3NRV7_GASAC/72-182                    ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A2I3HLU6_NOMLE/50-160                ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A452QD55_URSAM/127-237               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A096NPC8_PAPAN/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A671EQM4_RHIFE/133-242               ................................................hhfmfkm----SPASQG....VIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...ECEE.VVVQN......N.LCFGKCG....SVR.FPG....A.A....Q....S---...--.............................................LHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
M7BVA2_CHEMY/2286-2394                 ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MY...QETCRTLPFS.......Q.SIV.....H..E...NCEK.VVVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPTKFT.MK...........HLEL...N.C......T-.........-.R...S...V..A.V...V...K...V...V....M....I....V.....E.....DCKCEI-q.................................................
A0A4Z2FMM5_9TELE/19-117                ............................................rslrpggkedg----------....---.--...--...--..--...-KSCQKVTVR.......M.TIR.....K..N...DCRSnRPVNI......V.SCDGKCP....SAS.IYN....Y.N....I....NT--...--.............................................YAR.FCKCCRETGLQ.RR...........SVQL...Y.C......SG.........-.N...A...T..W.V...G...Y...G...I....Q....E....P.....T.....DCSCQW-s.................................................
A0A2I2Z433_GORGO/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A2U3YL33_LEPWE/132-241               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....AVR.FPG....A.E....Q....H---...--.............................................PHT.SCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..S.V...V...K...V...V....M....L....V.....E.....DCQCKM-k.................................................
A0A5E4QTJ9_9NEOP/3-98                  ...................................................vsvg----------....---.--...--...--..--...-QECQMTPVI.......H.VLQ.....H..P...GCVP.KPIPS......Y.ACIGKCT....SYV.QVS....G.S....K....I---...WQ.............................................MER.SCNCCQESGER.EA...........SVVL...F.C......P-.........-.K...A...K..S.E...E...K...R...L....R....K....V.....TtkaplECMC---rpc...............................................
E2QUD8_CANLF/78-189                    .............................................lhrgqevapt----------....VSL.PL...DL...QE..VV...QEMCRAVPFT.......Q.VLS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.IPS....L.D....P....A---...--.............................................PLV.LCNSCVPTRQR.WT...........PVVL...W.C......RA.........S.S...P...A..S.R...R...R...M...K....Ms.tvL....V.....E.....GCQCS--pk................................................
A0A093QCT6_9PASS/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A093FA51_TYTAL/48-151                .................................................lnkegl----ASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......H.---.....-..-...----.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A016UE08_9BILA/100-210               ................................................kplldgr-------NQA....LIT.IK...DT...RE..M-...-QRCEGSKFK.......Q.RVK.....A..P...GCLT.KVIVN......R.FCHGTCP....SYF.IPR....M.N....S....KILK...-A.............................................KFK.SCAACAPRDYD.AV...........DVTL...D.C......PG.........Q.D...P...P..Q.V...T...K...T...I....V....K....I.....K.....KCECI--dl................................................
A0A6G1AP48_CROCR/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A6G0ZAQ5_APHCR/19-129                ......................................nmafannngngvvvtar----------....---.--...--...--..-S...SDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACTGRCS....SYL.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..Q.G...E...K...K...F....R....K....V.....TtkaplECMC---rpc...............................................
GREM2_MOUSE/50-160                     ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEED...--.............................................SFQ.SCAFCKPQRVT.SV...........IVEL...E.C......PG.........L.D...P...P..F.R...I...K...K...I....Q....K....V.....K.....HCRCMS-v.................................................
#=GR GREM2_MOUSE/50-160          SS    ......................................................G-GTSCTHSH-....HCC.CC...CG...GG..CT...S-EEEEEEEE.......E.EE-.....-..T...TS--.EEEEE......E.EEEEEEE....EEE.EES....T.S....S....SS--...--.............................................EEE.EEEEEEEEEEE.EE...........EEEE...E.-......TT.........S.S...S...S..E.E...E...E...E...E....E....E....E.....E.....EEEEEE-E.................................................
A0A5N3XMU5_MUNRE/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A091PC89_LEPDC/71-175                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.SM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....E------..................................................
BURS_AEDAE/21-128                      .............................................lnaqkesndd----------....---.--...-I...QH..YT...ADDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..N.G...E...K...K...F....K....K....V.....StkaplECMC---rpc...............................................
A0A2F0B5M0_ESCRO/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSL.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A674CBL6_SALTR/59-169                ......................................................q-EILASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....TEQD...--.............................................SFR.SCAFCRPQRFT.TL...........TVEL...D.C......PD.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
A0A4U1FS04_MONMO/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
D3ZGN3_RAT/74-183                      ............................................ggqsvaagvpl----------....---.PL...AP...QE..LL...QETCKALPFV.......Q.VIS.....R..P...GCTS.ARVLN......H.LCFGHCS....SFY.IPS....S.D....P....S---...--.............................................PVV.LCNSCVPSRRR.WT...........SVAL...W.C.....gAG.........Q.S...A...S..P.R...R...V...R...I....St..vL....V.....Q.....KCQCH--pr................................................
G0NH36_CAEBE/238-351                   ..................................................etile-----GRKHA....LLQ.LA...DP...DA..LR..mNQKCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGTCA....SIY.IPR....M.H....S....KKLK...-A.............................................AFR.SCAACAPAEYD.YV...........DITL...D.C......PG.........R.N...P...P..T.A...T...K...T...I....V....K....V.....K.....SCKCKE-v.................................................
A7RW37_NEMVE/1-93                      ....................................................msl----------....---.KL...KR...ND..LR...GDWCKLRPVL.......Q.KLH.....H..P...GCNS.SFIMN......N.MCYGQCM....SFF.IPR....H.-....-....----...--.............................................-FT.SCAFCTPVSKN.VV...........SVHL...K.C......A-.........-.G...D...L..K.V...V...K...K...V....S....I....I.....Q.....SCSCR--pc................................................
E1BD70_BOVIN/14-124                    .......................................lllavtegqsqqaaip----------....---.--...--...--..--...--GCYLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.VSQCCTISSLR.KV...........KVQL...H.C......G-.........-.G...N...R..K.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A674CJ16_SALTR/68-178                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LK...LDWCKTQPLK.......Q.TIH.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....EDDG...--.............................................AFQ.SCSTCKPKTFT.TV...........TYTL...I.C......PG.........Q.S...P...S..S.R...K...K...R...V....Q....R....V.....K.....TCRCAS-i.................................................
A0A0P7UX15_SCLFO/48-159                .....................................................kq-EVLASSQE-....ALV.VT...ER...KY..LR...SDWCKTQPLR.......Q.TVA.....E..E...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.I....R....KEQE...--.............................................AFQ.SCAFCRPNKFT.TL...........TVEL...D.C......PG.........L.Q...P...P..F.R...H...R...K...I....Q....C....V.....K.....QCRCIS-v.................................................
A0A3Q2TTE0_CHICK/316-427               ...........................................sslsvtsglsts----------....-LS.PV...RP...ST..VP...QEFCKKVEYE.......E.NIT.....Y..K...GCSA.-NVTL......S.RCEGLCP....SST.KLN....V.E....N....----...MV.............................................FSA.ACSCCRPLQLH.KE...........KFQL...P.Ce....dPD.........N.P...G...K..R.L...T...K...E...I....T....V....F.....G.....GCVCN--fd................................................
A0A3L8SX70_CHLGU/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A556TWW5_BAGYA/48-158                ......................................................q-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVN.....H..E...GCLS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KEQE...--.............................................SFQ.SCAFCRPHRFT.TL...........TVEL...D.C......PD.........L.Q...P...P..F.R...H...R...K...I....Q....R....V.....K.....QCRCIS-v.................................................
D2H4S2_AILME/19-124                    ...........................................tegwgrqaaipg----------....---.--...--...--..--...---CHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnVTS.VSQCCTISGLK.KV...........KVQL...Q.C......G-.........-.G...D...R..R.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A2Y9FNM2_PHYMC/134-244               .............................................hrfmfrmspv-------SQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.AVVQN......N.LCFGKCG....SVR.FPG....G.A....A....QHP-...--.............................................-PT.FCSHCLPAKFT.TM...........HLQL...T.C......A-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....ECQCKV-k.................................................
H3A159_LATCH/147-256                   ..........................................nnflfrrganfqe----------....LVL.PI...KT...NE..VQ...QETCRTLPFS.......Q.SIV.....H..E...NCEK.VVVQN......K.LCFGRCT....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPNKFT.MN...........RMEL...N.C......T-.........-.G...S...T..T.V...V...K...V...V....M....V....V.....E.....ECKCEV-q.................................................
A0A2A4K923_HELVI/18-129                ....................................qlhdkpvraqqsvevqlpp----------....---.--...--...--..--...GQECQMTPVI.......H.ILK.....H..P...GCIP.KAIPS......F.ACIGKCS....SYV.QVS....G.S....K....I---...WQ.............................................MER.TCNCCQESGER.EA...........SVVL...V.C......PK.........-.-...A...K..S.E...D...R...K...F....R....K....I.....TtkaplECMC---rpc...............................................
L5MGD9_MYODS/136-245                   ................................................hrfmfrm----SPASQG....VIL.PI...KS...HE..VH...QETCRTLPFS.......Q.TVA.....H..E...DCEE.VVVQN......N.LCFGKCG....SAR.FPG....A.A....Q....H---...--.............................................PHT.FCFHCSPARFT.TM...........HLPL...N.C......S-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCK--dl................................................
A0A3P8UMW9_CYNSE/67-171                ...........................................lahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..A...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........nE.E...A...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A6Q2YCY8_ESOLU/15-117                ......................................csaappahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...AANLvPSKTG......Q.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQHSgVV...........ALPG...H.C......QS.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------cskegprmgthht.....................................
A0A2U9CDG4_SCOMX/139-271               ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSSG...QAqnrgqasgs..........................grknhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A5S7WI71_MACMU/127-237               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A1W4WQA4_AGRPL/21-126                ..............................................lnleitssf----------....---.--...--...QK..IT...PSWCQTTAIK.......Q.IVA.....S..P...GSEP.VTIDN......N.VRVEVCY....SYS.IPR....T.R....P....AEPG...EL.............................................IGP.YCDSCKPADSR.CY...........HMTL...H.D......DK.........N.S...S...K..T.I...Q...K...R...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A0V0VJN8_9BILA/150-277               .....................................skksrqrskqqqqqqqqq---LYPNKRQ....AYI.IA...SR...DV..IR...TDYCRTIAFK.......Q.RIR.....I..E...GCLS.KTVIN......S.FCYGQCN....SFY.IPR....L.H....G....VRLM...-A.............................................SFK.SCSVCQPSQIT.SI...........TVTL...H.C......PG.........R.L...G...S..V.H...R...R...K...Y....L....K....V.....K.....QCACMA-v.................................................
A0A093HZX2_STRCA/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
G1Q507_MYOLU/23-123                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A4U5VFM5_COLLU/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
G1KVG4_ANOCA/65-181                    ........................................ktilscdeetepipd----------....TLH.VT...EE...NY..LN...QGWCKTQEIS.......Q.TIH.....E..E...GCKS.YTFIN......R.FCYGQCN....SFY.IPW....H.I....H....DKRG...--.............................................VFQ.ACYFCKPKRFT.TI...........TVIL...H.C......PD.........L.L...P...P..R.K...R...M...R...V....R....Q....A.....E.....DCHCV--pv................................................
H3C0F2_TETNG/129-244                   ........................................mwqkamnkgptmavs----------....--L.PA...SL...KD..G-...RQTCSAVPFT.......Q.RVT.....A..A...GCSS.VTVHN......K.LCFGQCS....SLF.VPS....E.V....P....LGAG...TAf..........................................lhHQG.PCSRCAPSKAQ.AV...........VVPL...L.C......--.........-.G...A...R..V.Q...Q...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A087VRZ2_BALRE/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLNL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A3M0JH15_HIRRU/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A5J5CNG1_9PERO/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........SFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A553Q7X7_9TELE/37-96                 .............................................hidrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..D...GCMA.RSVHN......R.VCLGQCF....SYS.VPN....T.F....P....QST-...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------eslc..............................................
A0A091CQE7_FUKDA/75-186                .............................................lkqgegvaaa----------....MSL.PL...DP...QE..VA...QERCRAVLFV.......Q.VLS.....R..P...SCTA.ARVHT......Q.LCFGQCS....SPY.VPG....S.V....T....A---...--.............................................SRT.LCNSCAPTRKR.RA...........PVVL...W.Cr...vgSP.........A.S...P...Q..W.V...K...T...S...T....V....L....V.....E.....GCQCS--lk................................................
A0A484GY64_SOUCH/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2I0TY14_LIMLA/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...D.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A2I3HMH1_NOMLE/135-244               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.A....Q....P---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...L...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
D2H275_AILME/30-130                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....LCSCQA-c.................................................
A0A1S3N4K5_SALSA/51-176                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....S....PSSN...RGpgsgrk................................nhnkaqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PG.........L.Q...P...A..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A498S8J7_ACAVI/119-240               ...........................kkvisspkealqqvnqevslgrlddsrp----------....---.--...--...--..--...VAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TV...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A2U3V487_TURTR/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
B0BN87_RAT/135-244                     .............................................hrfmfrkgpa-------SQG....VIL.PI...KS...HE..VH...WETCRTVPFN.......Q.TIA.....H..E...DCQK.VTVQN......N.LCFGKCG....SIH.FPG....E.G....A....H---...--.............................................PHN.FCSHCSPTKFT.TT...........HLRL...N.C......T-.........-.S...P...T..P.V...V...K...M...V....I....Q....V.....E.....ECQCMV-k.................................................
A0A2I0UTD4_LIMLA/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...GCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFF.MK...........RLGL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A1A6HFZ5_NEOLE/72-183                .............................................lqggqrvaag----------....VSL.PL...AP...QE..VL...QETCKAVAFI.......Q.VLS.....R..P...GCTA.ARVVN......H.LCFGHCS....SFY.IPS....S.D....P....T---...--.............................................PVV.LCNSCVPAQKR.WT...........SVVL...W.Cg...agYK.........A.S...P...R..R.V...R...M...T...V....T....L....V.....Q.....KCQCS--pk................................................
Q17JY7_AEDAE/139-291                   ......................................................d-KLLKSSKN-....ALV.VT...RK...EY..LK...KDWCKTEPLV.......Q.RIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPK....S.P....K....RRRH...GGgggggrnghgghggagghgh.....hggrarevdldfededltgpAFR.SCAFCKPKKFT.WI...........TVTL...R.C......PS.........L.V...P...Q..L.R...R...K...R...I....Q....R....I.....K.....QCKCIA-e.................................................
I3N5H1_ICTTR/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A5F4CZS0_CANLF/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
I3L016_ORENI/123-233                   ..................................................yevpe------SSQE....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIE.....E..E...GCLR.RTIIN......R.FCYGQCN....SFY.IPR....N.K....Y....QDGN...--.............................................AFR.SCSACKPKSFS.TV...........TYTL...L.C......PG.........Q.T...P...S..T.K...R...K...R...V....Q....R....V.....K.....LCRCTT-i.................................................
I3MRI0_ICTTR/57-169                    .............................................lqdgqevtts----------....VSL.PL...DP...KE..VT...QEMCKAVPFI.......Q.VLS.....R..P...GCTA.VRVRN......H.LCFGRCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCEPTRQR.WT...........PMVL...W.C......RP.........G.S...P...A..S.S...R...R...R...VkvstR....L....V.....E.....GCRC---gpk...............................................
A0A3Q1EHT7_9TELE/52-182                ....................................................kpe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TIS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....G....PSHG...QSrghgsgsg............................rknhnkvqePFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PD.........L.Q...P...P..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
A0A444TZS7_ACIRT/83-189                ................................................afrrrsd-------SQE....TIV.PI...KT...TA..VQ...QQTCRALPFL.......Q.SVV.....H..E...NCEK.VVLKN......N.LCFGRCS....SVH.VPG....N.E....G....R---...--.............................................TYT.ICSYCVPTNFT.TK...........TVEL...K.C......K-.........-.G...S...V..S.V...T...K...L...V....M....L....V.....E.....ECQCEA-q.................................................
A0A2T7PAC9_POMCA/72-184                ...................................vlvslssaavvttssihtpt----------....---.--...--...--..--...GGSCEPSLGS.......M.EIR.....Y..K...NCTP.MVVPV......L.ACTGRCE....SYA.RPD....P.N....N....P---...IV.............................................LQR.DCQCCSELERV.ER...........YVRL...R.C......PS.........P.N...D...P..H.Q...V...-...-...-....-....-....-.....-.....-------elyrfplsfprncacrp.................................
G0NGX1_CAEBE/21-120                    .............................................vacllqycaa----------....---.--...--...AV..TK...NNSCKKVGVE.......E.LID.....E..E...GCDL.MIIRI......N.RCSGHCF....SFT.FPN....P.L....T....KKY-...--.............................................-SV.HAKCCRMVEWE.ML...........ETEL...K.C......S-.........-.-...E...G..N.R...K...L...R...I....P....S....A.....T.....QCECF--dc................................................
A0A3P8UMY6_CYNSE/19-123                ...........................................lahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..A...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG........nE.E...A...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A5E4M6B4_9HEMI/31-139                ......................................nstfrkhkvhnivlypd----------....---.--...--...--..-K...HSWCTSTPIK.......Q.VIS.....D..V...DCNP.VEIDN......R.VCLGACF....SYS.IPR....T.L....P....VNNV...DE.............................................VNS.YCDSCQPIKTL.WI...........PVQL...T.C......T-.........-.D...G...S..N.R...T...K...H...V....Q....L....I.....N.....ECRCSS-c.................................................
A0A5E4MJ59_9HEMI/18-134                ........................................hskqlessavtwqsp----------....--S.VT...GS...DT..WQ...KPGCHKVGHT.......R.KIS.....I..P...NCVE.FHITT......N.ACRGYCE....SWA.VPS....P.A....D....TVMI...NPh..........................................qrITS.VGQCCNIMETE.DV...........EVNV...R.C......L-.........-.-...E...G..V.R...K...L...V...F....K....S....A.....L.....SCSCY--hc................................................
G1NRR1_MELGA/49-160                    .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A1Y3B432_EURMA/87-187                ..........................................siiysnlgqalps----------....---.-M...LA...KH..SR...DGSCKTVPFE.......Q.KIQ.....H..P...GCKS.RIVNN......N.YCFGNCN....SFY.IPS....E.S....N....QTL-...--.............................................PFQ.SRCTCSPRRYR.WK...........IIRL...R.C......PL.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------yrhrhfssssti......................................
B0WSH1_CULQU/42-140                    ...................................................gaqt----------....ATV.HN...DI...QH..YT...ADDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........-.-...A...K..N.G...E...K...K...-....-....-....-.....-.....-------fkkfggis..........................................
A0A084WD69_ANOSI/275-421               ......................................................d-KLLKSSKN-....ALL.VT...RK...EY..LK...KDWCKTEPLV.......Q.RIR.....E..E...GCLS.RTIVN......R.FCYGQCN....SFY.IPK....S.P....K....RSRR...GNhhgkaatatttasyaas...........grgrgdidfededltgpAFR.SCAFCKPKKFT.WV...........TVTL...R.C......PS.........L.V...P...S..L.R...R...K...R...I....Q....R....I.....K.....QCKCIA-e.................................................
A0A0A0AX61_CHAVO/143-251               ................................................hfmlkkn-----SASEE....IVL.PI...KT...NE..MH...LENCRTLPFS.......Q.GVT.....H..E...SCQK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A091JW64_COLST/40-151                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q1LX74_BOVIN/127-237               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
G3WF61_SARHA/50-160                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........Q.D...P...P..Y.R...H...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A3Q1EY76_9TELE/27-142                ...................................qsvssnkasdkghphlgdad----------....---.--...--...--..--...PERCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGHCS....HTT.RSD....PlI....S....FSSV..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AVRL...R.C......A-.........-.G...G...T..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
U4UXP2_DENPD/32-144                    .......................................ccerehkvhnivlype----------....---.--...--...--..-K...HSWCQTTPIQ.......Q.VVS.....A..P...GYEP.VTIQN......N.VCVGACF....SYS.IPK....S.E....P....AEPG...EL.............................................IRP.YCDSCQPSEIK.CY...........HVNL...Q.A......DGn......kvE.V...P...A..V.L...Q...K...R...V....Q....V....I.....R.....NCSCQS-c.................................................
A0A2I3RC67_PANTR/57-157                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3Q3LX70_9TELE/29-142                .....................................ansnkasdgghphlgesd----------....---.--...--...--..--...PDRCMRHHFV.......E.TIT.....H..Pi.yKCNS.KMVLL......A.RCEGRCS....RTT.RSD....PlI....S....FSSL..lKQ............................................pFKS.TCSCCRPHTSK.LK...........AMRL...R.C......A-.........-.G...G...I..R.I...T...A...T...Y....R....Y....I.....L.....ACNCEE-c.................................................
S7MYP4_MYOBR/659-768                   ................................................hrfmfrm----SPASQG....VIL.PI...KS...HE..VH...QETCRTLPFS.......Q.TVT.....H..E...DCEE.VVVQN......N.LCFGKCG....SAR.FPG....A.A....Q....H---...--.............................................PHT.FCFHCSPARFT.TM...........HLPL...N.C......S-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECRCKV-k.................................................
M7BEX3_CHEMY/71-181                    ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.HTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A4W2G6F6_BOBOX/127-237               ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A096P1I6_PAPAN/137-246               ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...GCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.E....Q....H---...--.............................................SHT.FCSHCLPAKFT.TM...........HLPL...N.C......T-.........-.E...V...S..S.V...I...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
CER1_MOUSE/135-244                     ..............................................hrfmfrkgp---------Af.qgVIL.PI...KS...HE..VH...WETCRTVPFN.......Q.TIA.....H..E...DCQK.VVVQN......N.LCFGKCS....SIR.FPG....E.G....A....D---...--.............................................AHS.FCSHCSPTKFT.TV...........HLML...N.C......T-.........-.S...P...T..P.V...V...K...M...V....M....Q....V.....E.....ECQCMV-k.................................................
A0A5E4BPF3_MARMO/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3R7MBC0_PENVA/34-139                ............................................tllllalvfag----------....---.--...--...--..TQ...ADECSLTPVI.......H.ILS.....Y..P...GCNS.KPIPS......F.ACQGRCT....SYV.QVS....G.S....K....I---...WQ.............................................TER.SCMCCQESGER.EA...........SVTL...N.C......PK.........A.R...P..gE..P.R...M...R...K...I....L....Tr..aP.....I.....DCMC---rpc...............................................
A0A3P7U488_9BILA/28-158                ...................kqlksekkgkkmisspkealhqvnqevslgrlddsr----------....---.--...--...--..-P...TAHCDGQIFK.......Q.RIR.....M..D...GCLS.KVVHN......R.FCHGTCS....SYF.IPR....L.R....P....RKLK..lDA.............................................MFQ.SCSVCRPAEWD.TI...........EVKL...D.C......PR.........K.N...P...K..E.L...K...R...K...V....I....K....V.....K.....KCKCIA-l.................................................
A0A5E4BSK7_MARMO/919-1028              .............................................hhfmfrkgpa-------SQG....VIL.PI...KS...HE..VH...WETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVH.FPG....A.T....P....H---...--.............................................PHT.FCSHCSPAKFT.TV...........HLQL...N.C......TG.........-.-...L...A..P.V...I...K...V...V....M....Q....V.....E.....ECQCA--vt................................................
A0A672FGL4_SALFA/64-174                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..E...GCLS.RAIIN......R.FCYGQCN....SFY.IPR....H.V....Y....QDGG...--.............................................AFQ.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.T...P...S..T.R...R...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
R0LGE4_ANAPL/32-131                    ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3Q7WBY3_URSAR/133-242               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.MIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SAR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
B0W0F5_CULQU/143-292                   ......................................................d-KLLKSSKN-....ALV.VT...RK...EY..LK...KDWCKTEPLV.......Q.RIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPK....S.P....K....RPRR...HGgqnnnggrgghhhrnggt........papprevdldfededltgpAFR.SCAFCKPKKFT.WI...........TVTL...R.C......PS.........L.V...P...Q..L.R...R...K...R...I....Q....R....I.....K.....QCKCIA-e.................................................
A0A2Y9STA6_PHYMC/22-119                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVSTaarS.C......PA.........-.S...A...Q..S.R...-...-...-...-....-....-....-.....-.....-------hrpwpqvlsva.......................................
A0A2Y9GJ55_NEOSC/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A4W5N4U3_9TELE/72-182                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...S..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A1L8HY40_XENLA/211-316               .................................................lvkmng------APQN....TSH.GG...KA...QE..IM...KEACKTLPFT.......Q.NIV.....H..E...NCDK.MVIQN......N.LCFGKCI....SLH.VPN....Q.Q....H....RQ--...--.............................................--N.TCSHCLPSKYT.LN...........HLAL...N.C......T-.........-.G...S...S..N.V...L...K...V...V....M....M....V.....E.....ECTCEA-h.................................................
A0A093C748_9AVES/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...I....M....I....V.....E.....ECKCET-q.................................................
A0A091VFN4_NIPNI/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLSFS.......Q.GVT.....H..E...NCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....E.....ECQCET-q.................................................
W5ML90_LEPOC/20-123                    ............................................ahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDACSPAQVL.WE...........VVTL...E.C......PG........nA.E...A...P..R.V...D...K...L...V....E....R....I.....L.....HCSCQS-c.................................................
A0A094KLW4_ANTCR/49-160                .....................................................nk-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPHKVT.SS...........TVQL...E.C......PE.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
S7Q8L6_MYOBR/6-117                     ..............................................lqheqevat---------T....MSL.PL...DP...QE..VA...QETCKAVPFT.......Q.VLS.....Q..P...GCMA.KRLRN......H.LCFGHCS....SLY.VPG....V.D....L....A---...--.............................................PFV.LCNSCVPARRH.WT...........PVFL...W.C......RV.........-.G...S...P..A.S...R...R...R...V....KtytvL....V.....E.....RCQCS--lk................................................
A0A4W4FCC7_ELEEL/47-158                ....................................................eqs--VLESSHE-....ALH.VT...ER...NY..LK...RDWCKTQPLK.......Q.TLY.....E..E...GCIS.RTIIN......S.FCYGQCN....SFY.IPR....H.V....Y....QEDS...--.............................................AFQ.SCSFCKPKTFT.FV...........TYAL...I.C......PG.........Q.N...P...R..T.R...R...K...R...V....R....R....V.....K.....QCRCTS-i.................................................
A0A1U7Q345_MESAU/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A0D9S8D7_CHLSB/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3P8UXP9_CYNSE/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...MDWCKTQPLK.......Q.TIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....EDGH...--.............................................VFE.SCSACRPKTFS.TV...........TYTL...F.C......PG.........L.T...P...N..T.R...R...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
J9LHE2_ACYPI/28-132                    ..................................................pspla----------....---.-T...GS...NT..WQ...KPGCHKVGHT.......R.KIS.....I..P...NCVE.FPITT......N.ACRGYCE....SWA.VPS....P.A....D....TVMI...NPh..........................................qrITS.VGQCCNIMETE.NV...........EVNV...R.C......L-.........-.-...E...G..V.R...K...L...V...F....K....S....A.....L.....SCSCY--hc................................................
A0A4Z2J5B2_9TELE/1-38                  .......................................................----------....---.--...--...--..--...----------.......-.---.....-..-...----.-----......-.-------....---.---....-.-....-....----...--.............................................---.-----MPAQTQ.WE...........VVTL...E.C......PG........sE.E...S...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A384D0C7_URSMA/71-181                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
M3YW73_MUSPF/59-169                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..D...GCRS.RTVLN......R.FCYGQCN....SFY.IPR....H.V....R....KDEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........M.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
H9GK33_ANOCA/45-144                    ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSL.WE...........IVTL...D.C......PS.........N.E...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A0P7Z6M3_SCLFO/99-213                ......................................vmlqsapstaqsghlge----------....---.--...--...--..ND...PDRCMRHHFV.......E.TIT.....H..Pi.yKCSS.KMALL......A.RCEGHCGr..sSRS.EPL....I.S....F....SSVL...KQ............................................pFQS.SCACCRPHSSK.LK...........AVRL...R.C......S-.........-.G...G...L..R.I...T...A...T...Y....R....Y....I.....L.....SCSCEE-c.................................................
A0A1N8XHL8_CHICK/40-139                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
C6SUP2_AEDAE/7-117                     ..............................................atlvllatm----------....---.AC...AR...ET..WQ...KPGCHKVGHT.......R.KIS.....I..P...DCVE.FSITT......N.ACRGFCE....SFA.VPS....D.P....F....AVGQ...HKps.........................................qpVTS.VGQCCNIMETE.DV...........KVRV...L.C......V-.........-.-...N...G..I.R...N...L...T...F....K....S....A.....T.....NCSCY--hc................................................
H0X5P7_OTOGA/135-244                   ................................................hhfmfrk-------SPAs.qgVIL.PI...KS...HE..IH...WETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......H.LCFGKCG....SVH.FPG....A.A....Q....H---...--.............................................SHI.FCSHCSPTKFT.TM...........HLPL...N.C......T-.........-.S...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKV-k.................................................
A0A1S3Q7B7_SALSA/141-260               .....................................qramdkshhsktmsmslp----------....---.LS...LK...DS..AN...RQSCAAVPFT.......Q.RIT.....S..E...GCDA.VTVHN......K.LCFGQCS....SLF.VPS....G.W....D....SARL...TGag.........................................rhRRA.PCSRCAPSKAH.TV...........TVPL...R.C......--.........-.G...M...E..V.R...E...K...R...V....M....V....V.....E.....ECKCET-g.................................................
A0A665TKX0_ECHNA/66-176                ......................................................d-EVLESSQE-....ALH.VT...ER...RY..LR...LDWCKTQPLK.......Q.TIR.....E..E...GCLS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....Y....QDGN...--.............................................AFE.SCSACKPKTFS.TV...........TYTL...F.C......PG.........Q.R...P...S..T.R...K...K...R...V....Q....R....V.....K.....QCRCTT-i.................................................
G5BGU0_HETGA/41-154                    ..............................................hserwqhqi-------XQE....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....G..E...GCRS.RTILN......R.FCYGQCN....SFY.IPR....H.V....K....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A6A1QET5_BALPH/187-296               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...RETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SVR.FPE....A.A....Q....H---...--.............................................PYT.FCSHCLPAKFT.RM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...L...V....M....L....V.....E.....GCQCKA-k.................................................
R0KDQ4_ANAPL/71-181                    ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
A0A452SBH7_URSAM/133-242               ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFG.......Q.MIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SAR.FPG....A.A....Q....H---...--.............................................PHT.FCSHCSPAKFT.TM...........HLQL...N.C......T-.........-.G...L...A..P.V...V...K...V...V....M....L....V.....E.....ECQCKM-k.................................................
L9L8C5_TUPCH/235-345                   ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...S..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A2K5X5U6_MACFA/76-188                ............................................rlqrgqdevaa----------....VTL.PL...NP...QE..VT...QGMCKAVPFV.......Q.VFS.....R..P...GCSA.TRLRN......H.LCFGHCS....SLY.IPG....S.D....P....T---...--.............................................PLV.LCNSCMPARKH.SA...........PVVL...W.C.....hTG.........S.S...A...S..R.R...R...V...K...I....Tt..vL....I.....E.....GCHCS--lk................................................
A0A498LLI6_LABRO/126-232               .................................................qkvmhk------SERSk.eaVAL.RI...DP...KD..MT...KQSCAA----.......-.RIT.....E..D...GCET.VTVHN......N.LCYGQCS....SMF.VPS....S.G....E....SRGQ...--.............................................QRA.PCTRCGPSKSR.FV...........LVPL...R.C......--.........-.G...T...E..V.R...E...R...R...V....M....I....V.....E.....ECKCET-s.................................................
H3B020_LATCH/48-159                    .....................................................kq-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCHS.RTVIN......R.FCYGQCN....SFY.IPR....H.V....K....KDQE...--.............................................SFQ.SCAFCKPQKFT.TL...........TVRL...D.C......PD.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCIS-v.................................................
A0A091U7R9_PHALP/143-251               ................................................hfilkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...RCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.N...S...V..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
A0A1V4J4N6_PATFA/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GIT.....H..E...TCEK.VMVQN......N.LCFGKCS....SFH.VPG....P.E....D....R---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.S...S...V..P.V...V...K...E...V....M....I....V.....K.....ECKCEI-q.................................................
U3J654_ANAPP/22-122                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091JQM8_COLST/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...NCEK.VTIQN......N.LCFGKCS....SFH.VPG....P.E....D....H---...--.............................................LYT.FCSRCLPSKFF.MK...........HLHL...N.C......T-.........-.S...S...T..P.V...V...K...E...V....M....I....V.....E.....ECKCET-r.................................................
A0A6A1Q373_BALPH/22-122                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSL.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3P9P1G4_POERE/57-167                ......................................................e-EILESSQE-....ALL.VT...ER...RY..LR...TDWCKTQMLK.......Q.TIQ.....E..E...GCLS.RTITN......R.FCYGQCN....SFY.IPR....H.T....Y....QDGG...--.............................................VFQ.ACSACRPKTFS.TI...........TLTL...F.C......PG.........Q.T...P...S..T.R...R...K...R...V....Q....R....V.....K.....QCRCV--ni................................................
A0A084VBL1_ANOSI/14-118                ..............................................pttngeksr----------....AAT.ED...GG...SH..YS...ADDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACIGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......P-.........-.K...A...K..N.G...E...K...K...F....R....K....V.....-.....-------cqqtr.............................................
A0A556TSI0_BAGYA/65-175                ......................................................q-EVLDSSQE-....ALH.VT...ER...HY..LK...RDWCKTQPLK.......Q.TLE.....D..E...GCIS.RTIIN......S.FCYGQCN....SFY.IPR....H.V....Y....QEEG...--.............................................AFQ.SCSFCKPKTFS.VV...........TYTL...I.C......PS.........Q.I...P...R..I.K...R...K...R...V....R....R....V.....K.....QCRCTS-i.................................................
A0A2U9BFP2_SCOMX/100-202               .............................................hinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...E.C......PG........sE.D...A...P..H.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A2A2J7E7_9BILA/398-509               ...................................pllgrkqvllaladsdamsl----------....---.--...--...--..--...PQKCHGQRFK.......Q.RVR.....V..P...GCLT.KIVVN......R.YCHGVCQ....SFF.IPQ....M.H....P....KRLK...-A.............................................AFV.SCSACSPSEYD.TV...........NVTL...D.C......PG.........Q.N...P...P..Q.V...T...K...S...I....M....K....V.....K.....KCSCI--ns................................................
A0A1Y1NG66_PHOPY/22-135                ......................................tlgdrehkihnivlype----------....---.--...--...--..-R...YSWCKTTAIK.......Q.VVA.....S..P...GYES.VTIDN......N.VCVGACY....SYS.IPI....T.R....P....AEPG...EL.............................................IRP.YCDSCQPARTR.CY...........HVTL...N.Ad...neNT.........E.G...P...K..S.I...K...K...R...I....Q....I....I.....T.....NCLCTS-c.................................................
A0A672JC15_SALFA/20-124                ...........................................pahinrlalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..T...GCQP.RSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQTQ.WE...........VVTL...D.C......PG.........N.E..dS...P..R.V...D...K...L...V....E....R....I.....F.....HCSCQS-c.................................................
A0A1S3EZU9_DIPOR/1-111                 ..............................................msraaytvg----------....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TVH.....E..E...GCTS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................SFQ.SCSFCKPKAFT.TM...........TVTL...N.C......PQ.........L.Q...P...P..T.K...K...R...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A1A6H0H5_NEOLE/77-187                ......................................................e-EVLESSQE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........MVTL...N.C......PE.........L.Q...P...P..T.K...K...K...R...V....T....R....V.....K.....QCRCIS-i.................................................
A0A3Q3GN99_9LABR/69-179                ......................................................d-EVLESSQE-....ALH.VT...ER...QY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCVS.RTIIN......R.FCYGQCN....SFY.IPR....H.I....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A091RQS2_NESNO/143-251               ................................................hfmlkkn-----SASEE....VVL.PI...KT...NE..MH...QENCRTLPFS.......Q.GVT.....H..E...SCEK.VMVQN......N.LCFGKCS....SFH.VPG....S.E....D....H---...--.............................................LYT.FCSHCLPSKFS.MK...........RLDL...N.C......T-.........-.G...S...F..P.V...V...K...E...V....M....I....V.....E.....ECKCET-q.................................................
L9L7G5_TUPCH/50-87                     ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.AAA.....-..-...----.-----......-.-------....---.---....-.-....-....----...--.............................................---.-----------.--...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------drer..............................................
T0MJB8_CAMFR/121-220                   ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
F7CAQ1_MONDO/57-167                    ......................................................k-EVLASSQE-....ALV.VT...ER...KY..LK...SDWCKTQPLR.......Q.TVS.....E..E...GCKS.KTILN......R.FCYGQCN....SFY.IPR....H.V....K....KDEE...--.............................................SFQ.SCAFCKPHRVT.SV...........LVEL...E.C......PG.........L.V...P...P..F.R...H...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A3KFI1_HUMAN/57-128                    ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.W-...........----...-.-......--.........-.-...-...-..-.-...-...-...-...-....-....-....-.....-.....-------ei................................................
A0A5F4DI85_CANLF/46-146                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A091LEB7_CATAU/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A384CLX3_URSMA/38-122                ...........................................ssnhserwqqqi----------....---.--...--...--..--...----------.......-.---.....-..-...--KE.AATPN......R.FCYGQCN....SFY.IPR....H.V....R....KEEE...--.............................................SFQ.SCAFCKPQRVT.SV...........LVEL...E.C......PG.........L.D...P...P..F.R...L...K...K...I....Q....K....V.....K.....QCRCMS-v.................................................
A0A401PD07_SCYTO/62-172                ......................................................d-EVLESSHE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEAG...--.............................................SFQ.SCSFCKPKRFT.TM...........TVTL...N.C......PD.........L.Q...P...S..I.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A131ZVK7_SARSC/1-95                  ....................................................mds----------....---.--...--...--..IQ...MSECHLRPVI.......H.ILQ.....R..S...GCIP.KPIPS......F.ACYGTCN....SYV.QVS....N.S....K....F---...WQ.............................................IER.SCNCCQEIGER.ET...........SITL...H.C......PN.........R.I...P...S..Y.R...K...V...I...T....K....A....P.....V.....ECLCR--pc................................................
A0A099YSC4_TINGU/71-181                ......................................................e-EVLESSQE-....ALH.IT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCNS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKKFT.TM...........TVTL...N.C......PE.........L.Q...P...P..R.K...K...K...R...I....T....R....V.....K.....ECRCIS-i.................................................
V9KZI4_CALMI/59-169                    ......................................................d-EVLESSHE-....ALH.VT...ER...KY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCSS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....KEEG...--.............................................SFQ.SCSFCKPKRFT.TM...........TVTL...S.C......PD.........L.Q...P...P..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A151J5U8_9HYME/51-160                .........................................rlsqlvhnivlypd----------....---.--...--...--..-K...HSWCKTTPIK.......Q.VVT.....W..P...QCSS.QELDN......N.VCVGACF....SYM.VPH....S.E....P....SAPG...DL.............................................IRP.YCDSCQPLDSV.WH...........TVML...D.C......KDe.......qN.N...P...V..T.M...Q...K...K...V....Q....I....I.....T.....NCSCSS-c.................................................
A0A1S3WQW7_ERIEU/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCTPAQSL.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A3P8XMB6_ESOLU/70-180                ......................................................e-EVLESSQE-....ALH.VT...ER...RY..LK...RDWCKTQPLK.......Q.TIH.....E..E...GCIS.RTIIN......R.FCYGQCN....SFY.IPR....H.V....R....REEG...--.............................................AFQ.SCSFCKPKRFT.TM...........TFTL...N.C......PD.........Q.Q...P...S..T.K...K...K...R...I....Q....R....V.....K.....QCRCIS-i.................................................
A0A455B469_PHYMC/22-142                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...SLvhcdscmpa..........................qsmweitlssLKD.HACPCVPR-AG.ME...........KVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A6A4IWN9_APOLU/25-136                .............................................trvllstimv----------....--T.CG...EE...SK..QR...RNECEVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACQGRCS....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........SVSL...F.C......PK.........A.K...P...G..E.R...-...-...K...F....R....K....V.....VtkaplECMC---rpc...............................................
A8Y458_CAEBR/23-121                    .............................................scllqycsag----------....---.--...--...-V..TK...NNSCKKVGSE.......E.LID.....E..E...GCDL.LIIRI......N.RCSGTCF....SFT.FPN....P.L....T....KKY-...--.............................................-SV.HAKCCRMVEWE.ML...........ETEL...K.C......S-.........-.-...E...G..T.R...K...L...R...I....P....S....A.....T.....QCECF--dc................................................
B4HM41_DROSE/28-141                    ....................................klctaqpdssvaatdndit----------....---.--...--...--..-H..lGDDCQVTPVI.......H.VLQ.....Y..P...GCVP.KPIPS......F.ACVGRCA....SYI.QVS....G.S....K....I---...WQ.............................................MER.SCMCCQESGER.EA...........AVSL...F.C......PK.........V.K...P...G..E.R...K..fK...K...V....L....T....Ka...pL.....ECMC---rpc...............................................
A0A091HDL3_BUCRH/31-132                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......RqACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
H9G2Y0_CAEEL/1-93                      ......................................................m----------....---.--...--...--..--...NQRCDGQKFK.......Q.RIR.....V..D...GCLT.KVVVN......R.LCHGACA....SIF.IPR....M.H....S....KKLK...-A.............................................AFR.SCAACAPAEYD.YV...........DITL...D.C......PG.........R.T...P...P..T.A...T...K...T...I....V....K....V.....K.....SCKCKE-v.................................................
A0A670JPV4_PODMU/133-240               ..................................................fmlkt------KSRSd..vIVL.PI...KT...NE..MY...QDTCSTIPFS.......Q.SIA.....H..E...NCED.LVVQN......N.LCFGRCS....SFH.VPG....L.E....D....R---...--.............................................LYT.FCSHCLPTKFS.TE...........RLEM...N.C......T-.........-.T...A...A..P.V...I...K...V...V....M....V....V.....E.....ECKCEV-q.................................................
A0A671G2G2_RHIFE/78-189                ..............................................lqrgqevat---------T....MFL.PL...DP...QE..VA...QERCKAVPFT.......Q.VLS.....R..L...GCTA.VRLRN......H.LCFGHCS....SIY.IPG....V.D....S....T---...--.............................................SLV.LCNSCAPTRRR.WA...........PVVL...W.C......QV.........-.G...S...P..A.S...R...R...R...V....KtstvL....V.....E.....ECQCS--pk................................................
A0A090L3R2_STRRB/10-126                ..............................skkkykkrkgkfqvsvenissfpqy----------....---.--...--...--..--...NSICKTEKIN.......V.LVN.....Y..N...NCIS.QEITS......E.YCYGTCY....SIF.IPK....I.L....Q....RKI-...KE.............................................SFQ.TVSSCVPVKYE.II...........KIRL...E.C......PN.........Q.S...P...D..H.V...Y...R...N...I....V....K....V.....N.....SCSCKQ-f.................................................
W5PWU0_SHEEP/135-244                   ................................................hhfmfrm----SPASQG....IIL.PI...KS...HE..VH...QETCRTVPFS.......Q.TIT.....H..E...DCEK.VVVQN......N.LCFGKCG....SLP.SPE....A.V....Q....H---...--.............................................PPT.FCSHCLPAKFT.TR...........HLEL...N.C......T-.........-.S...L...A..M.V...V...K...V...V....M....L....V.....E.....ECQCMV-k.................................................
A0A286ZLG5_PIG/212-311                 ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
W2TMF3_NECAM/3-101                     ..........................................llvtshhaiaygv----------....---.--...--...--..--...KYHCRKVGAE.......E.IID.....E..R...GCEL.MILRV......N.RCSGHCL....SFS.FPN....P.I....T....GRTS...--.............................................--V.HAKCCRMTDTE.WV...........NTEL...Q.C......E-.........-.-...D...G..P.R...P...I...K...I....P....S....A.....V.....QCECF--dc................................................
A0A091JZ80_COLST/32-131                ................................................klalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCES.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...D.C......PG.........N.D...E..iP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
B5SNL4_OTOGA/15-124                    ...........................................vlaftegqdqet----------....---.--...--...--..-A...IPGCHLHPFN.......V.TVRs..drQ..G...TCQG.SHVA-......Q.ACVGHCE....SSA.FPS....R.Y....S....VLVA...SGyr.........................................hnITS.ISQCCTISSLK.KV...........KVQL...Q.C......V-.........-.G...K...R..R.E...E...L...E...I....F....T....A.....R.....ACQCD--mc................................................
A0A452RKD5_URSAM/78-189                .............................................lhhgqevapt----------....VSL.PL...DP...QE..VA...QETCKAVPYT.......Q.VLS.....Q..P...GCTA.VHLRN......H.LCFGHCS....SLY.LPS....S.D....P....T---...--.............................................ALV.LCNSCAPTRKR.WT...........PVVL...W.C......WA.........G.S...P...A..S.R...R...RvktS...T....V....L....I.....E.....GCQCS--pk................................................
A0A1W4XBT8_AGRPL/108-223               ......................................................r-KMLKSSKN-....ALL.VT...KK...EY..LQ...KDWCKTEPLI.......Q.RIK.....E..P...GCLA.KNIIN......K.FCYGQCN....SFY.IPI....S.S....N....EEEK...VPk..........................................esAFK.SCSFCKPRRTV.WV...........TVLL...R.C......PQ.........K.V...P...L..Y.K...K...K...R...V....E....K....I.....K.....QCKCV--gi................................................
A0A1D5Q2D2_MACMU/23-123                ...............................................nklalfpd----------....---.--...--...--..-K...SAWCEAKNIT.......Q.IVG.....H..S...GCEA.KSIQN......R.ACLGQCF....SYS.VPN....T.F....P....QSTE...--.............................................SLV.HCDSCMPAQSM.WE...........IVTL...E.C......PG.........H.E...E..vP..R.V...D...K...L...V....E....K....I.....L.....HCSCQA-c.................................................
A0A4W5PMC6_9TELE/44-152                .....................................................pe--VLSSSRE-....ALV.VT...ER...RY..LR...RDWCKTQPLR.......Q.TVS.....E..E...GCRS.RTVVN......R.FCYGQCN....SFY.IPR....H.M....S....P---...-K.............................................PFQ.SCSFCRPHRIT.QL...........TVQL...D.C......PG.........L.Q...P...A..F.R...H...R...K...V....Q....R....V.....K.....QCRCMS-v.................................................
#=GC SS_cons                           ......................................................G-GTCCTHCH-....HCC.CC...CH...CC..CT...S-EEEEEEEE.......E.EE-.....-..T...TSB-.EEEEE......E.EEEEEEE....EEE.EEC....E.E....T....TCEE...--.............................................EEE.EEEEEEEEEEE.EE...........EEEE...E.S......TT.........S.S...S..SS..E.E...E...E...E...E....E....E....E.....E.....EEEEEE-C.................................................
#=GC seq_cons                          ......................................................c............................t...h+...psaCcspPlp.......Q.sls.....c..p...GCpu.+ol.N......+.hChGQCs....Sah.lPp....p.h....t....pptt..................................................shp.pCstCpPpchp.hh...........tVsL...p.C......Pt...........p...s...s..h.h...c...K...p...l....p....p....l.....c.....pCpC.s.h.................................................
//
DBGET integrated database retrieval system