GenomeNet

Database: Pfam
Entry: DUF3212
LinkDB: DUF3212
Original site: DUF3212 
#=GF ID   DUF3212
#=GF AC   PF11486.11
#=GF DE   Protein of unknown function (DUF3212)
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF SE   pdb_2euc
#=GF GA   27.00 27.00;
#=GF TC   33.80 180.90;
#=GF NC   20.70 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR021579;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   Members in this family of proteins are annotated as YfmB however
#=GF CC   currently no function for this protein is known.
#=GF SQ   4
#=GS YFMB_BACSU/1-120        AC O34626.1
#=GS YFMB_BACSU/1-120        DR PDB; 2EUC B; 1-113;
#=GS YFMB_BACSU/1-120        DR PDB; 2EUC A; 1-113;
#=GS A0A2N8FPN8_9PSED/1-110  AC A0A2N8FPN8.1
#=GS A8FAX0_BACP2/1-119      AC A8FAX0.1
#=GS Q65MK1_BACLD/1-121      AC Q65MK1.1
YFMB_BACSU/1-120                   MQYFSPEQQYNAWIVSDLVKQIFHKRAGCSPGIHELAVFAEEHFHIDIDFVFSIIMNIGDIE.FALTDEIEKKLSGYLSTLLPYVTADMFETSKANAHAFLSRRHGNAAYHLFVSDDAFMR.
#=GR YFMB_BACSU/1-120        SS    -----HHHHHHHHHHHHHHHHHHHHHBSS---HHHHHHHHHHTT---HHHHHHHHH--S--S.S-SSSHHHHHHHHHHHHHGGG--HHHHHHHHHHHHHHT-------------XXXXXXX.
A0A2N8FPN8_9PSED/1-110             ----------NAWVVSDLVKQIFHQRSGCSPGIHELSAFAEEHFHIDIDFVFSIIMNIGDIE.FALAEEIEKKLSSYLGALLPYVNAEMLETSKANANAFLSRRHGNAVYHLFVSDDAFMK.
A8FAX0_BACP2/1-119                 MYYFSAEQQFNAWVVSDLVKQLFQKWNPEEAKAEPLTLFAEQHFRISIDYLFSIIINIGDIE.-SIEQDPQDLLSSYLNILYPFVTRDMMKASMQNANEYLLKERDADVYQLFGCLPPLL-s
Q65MK1_BACLD/1-121                 MYYFSPEQQYNAWIISDLVKQIFSREGHQEADTHRFESFAARRFGINIDYVFSIIMNIGDPEeRRTASSTEDLLSSYLLSLLSFITKDMFQYSRENANQYLLNERNADVFHLFLPDSVLKK.
#=GC SS_cons                       -----HHHHHHHHHHHHHHHHHHHHHBSS---HHHHHHHHHHTT---HHHHHHHHH--S--S.S-SSSHHHHHHHHHHHHHGGG--HHHHHHHHHHHHHHT-------------XXXXXXX.
#=GC seq_cons                      M.YFSsEQQaNAWlVSDLVKQIFp+cusppsshHcLssFAEcHF+IsIDaVFSIIMNIGDIE.hulsp-hEchLSSYLssLLPaVTtDMhcsS+tNANtaL.+c+sssVYHLFlsDsshh+.
//
DBGET integrated database retrieval system