GenomeNet

Database: Pfam
Entry: DUF3255
LinkDB: DUF3255
Original site: DUF3255 
#=GF ID   DUF3255
#=GF AC   PF11631.11
#=GF DE   Protein of unknown function (DUF3255)
#=GF AU   Pollington J;0000-0002-8158-8998
#=GF SE   pdb_2joz
#=GF GA   25.00 25.00;
#=GF TC   26.40 286.80;
#=GF NC   22.00 18.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF CL   CL0116
#=GF DR   INTERPRO; IPR021664;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   Members in this family of proteins are annotated as YxeF however
#=GF CC   no function is currently known. The family appears to be
#=GF CC   restricted to Bacillus.
#=GF SQ   1
#=GS YXEF_BACSU/19-141  AC P54945.1
#=GS YXEF_BACSU/19-141  DR PDB; 2JOZ A; 2-124;
YXEF_BACSU/19-141             IMVSGCQQQKEETPFYYGTWDEGRAPGPTDGVKSATVTFTEDEVVETEVMEGRGEVQLPFMAYKVISQSTDGSIEIQYLGPYYPLKSTLKRGENGTLIWEQNGQRKTMTRIESKTGREEKDEK
#=GR YXEF_BACSU/19-141  SS    ---------SS---TT-EEEE------STTS-SEEEEEE-SSEEEEEEEETTTEEEE---EEEEEEE--SSSEEEEEEESTT-S-EEEEEE-STT-EEEEETTEEEEEEE----SSS------
#=GC SS_cons                  ---------SS---TT-EEEE------STTS-SEEEEEE-SSEEEEEEEETTTEEEE---EEEEEEE--SSSEEEEEEESTT-S-EEEEEE-STT-EEEEETTEEEEEEE----SSS------
#=GC seq_cons                 IMVSGCQQQKEETPFYYGTWDEGRAPGPTDGVKSATVTFTEDEVVETEVMEGRGEVQLPFMAYKVISQSTDGSIEIQYLGPYYPLKSTLKRGENGTLIWEQNGQRKTMTRIESKTGREEKDEK
//
DBGET integrated database retrieval system