GenomeNet

Database: Pfam
Entry: DUF3824
LinkDB: DUF3824
Original site: DUF3824 
#=GF ID   DUF3824
#=GF AC   PF12868.10
#=GF DE   Domain of unknwon function (DUF3824)
#=GF AU   Coggill P;0000-0001-5731-1588
#=GF SE   manual
#=GF GA   22.70 7.90;
#=GF TC   22.70 7.90;
#=GF NC   22.50 7.80;
#=GF BM   hmmbuild --amino HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Domain_of_unknown_function
#=GF DR   INTERPRO; IPR024436;
#=GF DR   SO; 0000417; polypeptide_domain;
#=GF CC   This is a repeating domain found in fungal proteins. It is
#=GF CC   proline-rich, and the function is not known.
#=GF SQ   812
#=GS A0A4U6XQ92_9PEZI/644-699    AC A0A4U6XQ92.1
#=GS A0A139HNL0_9PEZI/429-506    AC A0A139HNL0.1
#=GS A0A3M7AWJ3_HORWE/348-405    AC A0A3M7AWJ3.1
#=GS A0A3M7AWJ3_HORWE/397-486    AC A0A3M7AWJ3.1
#=GS A0A5N6ZL79_9EURO/304-377    AC A0A5N6ZL79.1
#=GS A0A5N5K296_9PEZI/524-571    AC A0A5N5K296.1
#=GS A0A0C9MGZ4_9FUNG/114-150    AC A0A0C9MGZ4.1
#=GS A0A0D2BWC7_9EURO/479-597    AC A0A0D2BWC7.1
#=GS A0A2J6T2U0_9HELO/599-749    AC A0A2J6T2U0.1
#=GS A0A319DWF9_9EURO/524-662    AC A0A319DWF9.1
#=GS A0A2U1MVF2_ARTAN/17-87      AC A0A2U1MVF2.1
#=GS A0A1Y2LKH8_EPING/601-753    AC A0A1Y2LKH8.1
#=GS F9XE98_ZYMTI/636-827        AC F9XE98.1
#=GS A0A1Y1JK43_PLAGO/54-158     AC A0A1Y1JK43.1
#=GS F0U958_AJEC8/417-526        AC F0U958.1
#=GS A0A395GJ13_9EURO/302-374    AC A0A395GJ13.1
#=GS A0A2N3N5F7_9PEZI/422-468    AC A0A2N3N5F7.1
#=GS J3KI03_COCIM/349-390        AC J3KI03.2
#=GS A0A094DD18_9PEZI/423-500    AC A0A094DD18.1
#=GS A0A3N4L4M6_9PEZI/263-318    AC A0A3N4L4M6.1
#=GS W9Y839_9EURO/483-592        AC W9Y839.1
#=GS G2WRI8_VERDV/510-640        AC G2WRI8.1
#=GS B5YNX9_THAPS/110-231        AC B5YNX9.1
#=GS A0A4Q7JFY5_METCM/641-767    AC A0A4Q7JFY5.1
#=GS A0A425BSJ7_9PEZI/463-511    AC A0A425BSJ7.1
#=GS A0A167RTY9_9PEZI/750-901    AC A0A167RTY9.1
#=GS A0A139HNL0_9PEZI/635-793    AC A0A139HNL0.1
#=GS A0A3N4M4W7_9PEZI/216-267    AC A0A3N4M4W7.1
#=GS A0A1W2TCT9_ROSNE/613-787    AC A0A1W2TCT9.1
#=GS A0A319DWF9_9EURO/269-339    AC A0A319DWF9.1
#=GS A0A2V5HPZ2_ASPV1/302-363    AC A0A2V5HPZ2.1
#=GS A0A1B7P428_9EURO/525-661    AC A0A1B7P428.1
#=GS A0A3N4M4W7_9PEZI/263-316    AC A0A3N4M4W7.1
#=GS A0A2B7ZQA7_9EURO/312-382    AC A0A2B7ZQA7.1
#=GS A0A4U6XQ92_9PEZI/512-643    AC A0A4U6XQ92.1
#=GS S2JHI7_MUCC1/121-203        AC S2JHI7.1
#=GS A0A1W2TCT9_ROSNE/395-458    AC A0A1W2TCT9.1
#=GS A0A0D2BFS9_9EURO/644-799    AC A0A0D2BFS9.1
#=GS A0A3M7AWJ3_HORWE/635-803    AC A0A3M7AWJ3.1
#=GS A0A5N6KUS3_9ROSI/545-701    AC A0A5N6KUS3.1
#=GS A0A3A2ZU51_9EURO/552-686    AC A0A3A2ZU51.1
#=GS A0A4Q4UHQ5_9PEZI/560-730    AC A0A4Q4UHQ5.1
#=GS G3XV77_ASPNA/556-686        AC G3XV77.1
#=GS A0A0S6X889_9FUNG/574-741    AC A0A0S6X889.1
#=GS W9Y839_9EURO/107-205        AC W9Y839.1
#=GS A0A0D1Z4Z7_9EURO/625-782    AC A0A0D1Z4Z7.1
#=GS A0A0D1Y3N1_9EURO/654-803    AC A0A0D1Y3N1.1
#=GS A0A4U0TPH1_9PEZI/506-604    AC A0A4U0TPH1.1
#=GS A1CSM6_ASPCL/393-490        AC A1CSM6.1
#=GS A0A1X7RXD3_ZYMTR/303-349    AC A0A1X7RXD3.1
#=GS A0A1L9STT0_9EURO/554-701    AC A0A1L9STT0.1
#=GS R0K5Y5_SETT2/571-717        AC R0K5Y5.1
#=GS A0A443HVL7_BYSSP/307-382    AC A0A443HVL7.1
#=GS A0A6J3LYF8_9PEZI/595-765    AC A0A6J3LYF8.1
#=GS A0A179F7R8_METCM/607-741    AC A0A179F7R8.1
#=GS A0A0J8RJW6_COCIT/347-391    AC A0A0J8RJW6.1
#=GS A0A0K8LFQ8_9EURO/377-478    AC A0A0K8LFQ8.1
#=GS F2SD33_TRIRC/551-673        AC F2SD33.2
#=GS A0A3N4M4W7_9PEZI/309-354    AC A0A3N4M4W7.1
#=GS A0A168JGH6_CORDF/451-561    AC A0A168JGH6.1
#=GS A0A1L9TGA8_9EURO/465-599    AC A0A1L9TGA8.1
#=GS A0A7H8QYA3_9EURO/261-326    AC A0A7H8QYA3.1
#=GS J3KI03_COCIM/510-672        AC J3KI03.2
#=GS A0A2B7ZQA7_9EURO/416-529    AC A0A2B7ZQA7.1
#=GS A0A2G7FKH8_9EURO/354-453    AC A0A2G7FKH8.1
#=GS A0A1V6Z231_PENNA/547-692    AC A0A1V6Z231.1
#=GS A0A4T0VLI6_9PEZI/496-624    AC A0A4T0VLI6.1
#=GS A0A1B8CI28_9PEZI/416-495    AC A0A1B8CI28.1
#=GS E3QDR6_COLGM/512-642        AC E3QDR6.1
#=GS A0A3D8Q8W0_9HELO/620-790    AC A0A3D8Q8W0.1
#=GS A0A423W6A9_9PEZI/831-974    AC A0A423W6A9.1
#=GS A0A150VE66_9PEZI/539-622    AC A0A150VE66.1
#=GS A0A150VE66_9PEZI/640-781    AC A0A150VE66.1
#=GS A0A317V8F6_9EURO/299-368    AC A0A317V8F6.1
#=GS A0A1V1TG51_9FUNG/407-474    AC A0A1V1TG51.1
#=GS W3XH82_PESFW/344-396        AC W3XH82.1
#=GS A0A2C5YVS7_9HYPO/28-92      AC A0A2C5YVS7.1
#=GS A0A553HVQ4_9PEZI/601-658    AC A0A553HVQ4.1
#=GS A0A177D9J9_ALTAL/595-748    AC A0A177D9J9.1
#=GS A0A0A1TGS9_9HYPO/569-721    AC A0A0A1TGS9.1
#=GS A0A370TQE2_9HELO/611-770    AC A0A370TQE2.1
#=GS G7XHH0_ASPKW/403-503        AC G7XHH0.1
#=GS A0A1J9SBG8_9PEZI/348-427    AC A0A1J9SBG8.1
#=GS A0A4Z1J7M5_9HELO/663-820    AC A0A4Z1J7M5.1
#=GS A0A0C9MGZ4_9FUNG/419-467    AC A0A0C9MGZ4.1
#=GS A0A0D2K9Q9_9EURO/364-452    AC A0A0D2K9Q9.1
#=GS A0A2N3N5F7_9PEZI/469-588    AC A0A2N3N5F7.1
#=GS A0A167BNN4_CORFA/568-705    AC A0A167BNN4.1
#=GS A0A425BTC8_9PEZI/434-507    AC A0A425BTC8.1
#=GS A0A2S7NRS5_9HELO/649-810    AC A0A2S7NRS5.1
#=GS A0A0F0I0U5_ASPPU/414-516    AC A0A0F0I0U5.1
#=GS M2TBE1_COCSN/345-430        AC M2TBE1.1
#=GS H1UXZ2_COLHI/467-515        AC H1UXZ2.1
#=GS A0A0C9MGZ4_9FUNG/487-519    AC A0A0C9MGZ4.1
#=GS A0A4U0XQT9_9PEZI/586-733    AC A0A4U0XQT9.1
#=GS A0A2B7XJD2_9EURO/305-375    AC A0A2B7XJD2.1
#=GS A0A0G3A5Q5_9ACTN/4-80       AC A0A0G3A5Q5.1
#=GS A0A2T3AHR6_9PEZI/859-1050   AC A0A2T3AHR6.1
#=GS A0A0F4GXD0_9PEZI/617-791    AC A0A0F4GXD0.1
#=GS G0SEH0_CHATD/485-525        AC G0SEH0.1
#=GS A0A1J9Q7U5_9EURO/310-379    AC A0A1J9Q7U5.1
#=GS C5G976_AJEDR/340-451        AC C5G976.2
#=GS A0A3M7AWJ3_HORWE/500-606    AC A0A3M7AWJ3.1
#=GS A0A0D2BFS9_9EURO/495-603    AC A0A0D2BFS9.1
#=GS A0A1Q5UC54_9EURO/541-684    AC A0A1Q5UC54.1
#=GS G2XR77_BOTF4/694-852        AC G2XR77.1
#=GS A0A179UYF2_BLAGS/468-605    AC A0A179UYF2.1
#=GS A0A165A7V2_XYLHT/202-299    AC A0A165A7V2.1
#=GS A0A317X6X5_9EURO/302-365    AC A0A317X6X5.1
#=GS W9XB18_9EURO/369-456        AC W9XB18.1
#=GS A0A425BSJ7_9PEZI/264-312    AC A0A425BSJ7.1
#=GS A0A163HMV4_DIDRA/361-431    AC A0A163HMV4.1
#=GS A0A139HNL0_9PEZI/536-622    AC A0A139HNL0.1
#=GS A0A168JB54_MUCCL/784-843    AC A0A168JB54.1
#=GS A0A1S9DDZ8_ASPOZ/304-375    AC A0A1S9DDZ8.1
#=GS A0A2T3BE08_AMORE/385-459    AC A0A2T3BE08.1
#=GS A0A5N6FP34_PETAA/274-340    AC A0A5N6FP34.1
#=GS A0A0D1ZLV8_EXOME/661-832    AC A0A0D1ZLV8.1
#=GS A0A0D2APJ8_9EURO/651-803    AC A0A0D2APJ8.1
#=GS A0A1X7RXD3_ZYMTR/399-478    AC A0A1X7RXD3.1
#=GS A0A3N4M4W7_9PEZI/346-419    AC A0A3N4M4W7.1
#=GS A0A6G1FTE2_9PEZI/552-722    AC A0A6G1FTE2.1
#=GS A0A2G7FKH8_9EURO/253-316    AC A0A2G7FKH8.1
#=GS A0A1G4B989_9PEZI/685-819    AC A0A1G4B989.1
#=GS A7EI77_SCLS1/520-622        AC A7EI77.1
#=GS C4JEK8_UNCRE/273-315        AC C4JEK8.1
#=GS A0A0U5FQN0_9EURO/371-476    AC A0A0U5FQN0.1
#=GS A0A1E1K211_9HELO/497-589    AC A0A1E1K211.1
#=GS E5R2F7_ARTGP/550-689        AC E5R2F7.1
#=GS A0A5N6ZL79_9EURO/563-702    AC A0A5N6ZL79.1
#=GS A0A2P7ZDN6_9PEZI/487-604    AC A0A2P7ZDN6.1
#=GS A0A2B7ZQA7_9EURO/566-703    AC A0A2B7ZQA7.1
#=GS A0A1V6P3Z4_9EURO/545-695    AC A0A1V6P3Z4.1
#=GS E9DDF0_COCPS/382-494        AC E9DDF0.1
#=GS A0A2J6QGU0_9HELO/640-788    AC A0A2J6QGU0.1
#=GS A0A2T2NGB3_CORCC/572-704    AC A0A2T2NGB3.1
#=GS A0A063BU25_USTVR/577-740    AC A0A063BU25.1
#=GS A0A4Q4Z1G4_9PEZI/605-772    AC A0A4Q4Z1G4.1
#=GS A0A5N6EDR8_9EURO/414-518    AC A0A5N6EDR8.1
#=GS A0A1E1K211_9HELO/637-791    AC A0A1E1K211.1
#=GS J3KI03_COCIM/287-350        AC J3KI03.2
#=GS A0A5N5DQ18_9PEZI/348-427    AC A0A5N5DQ18.1
#=GS A0A139ISU8_9PEZI/431-506    AC A0A139ISU8.1
#=GS A0A4Q7JFY5_METCM/464-566    AC A0A4Q7JFY5.1
#=GS A0A194X7G0_9HELO/634-780    AC A0A194X7G0.1
#=GS A0A2S7QP56_9HELO/514-606    AC A0A2S7QP56.1
#=GS A0A0S7DWY3_9EURO/377-477    AC A0A0S7DWY3.1
#=GS A0A150VE66_9PEZI/433-518    AC A0A150VE66.1
#=GS M7SU52_EUTLA/536-613        AC M7SU52.1
#=GS A0A6J3LYF8_9PEZI/380-457    AC A0A6J3LYF8.1
#=GS A0A1X7RXD3_ZYMTR/636-810    AC A0A1X7RXD3.1
#=GS A0A420YNZ3_9PEZI/551-686    AC A0A420YNZ3.1
#=GS G3JMF7_CORMM/253-331        AC G3JMF7.1
#=GS S3CWZ7_OPHP1/455-495        AC S3CWZ7.1
#=GS A0A423W6A9_9PEZI/477-555    AC A0A423W6A9.1
#=GS A0A1V6QJC9_9EURO/545-694    AC A0A1V6QJC9.1
#=GS A0A4Z1HB19_9HELO/637-791    AC A0A4Z1HB19.1
#=GS A0A0J8QS49_COCIT/28-142     AC A0A0J8QS49.1
#=GS A0A0D2DIH2_9EURO/472-589    AC A0A0D2DIH2.1
#=GS A0A161Y9K7_9PEZI/696-763    AC A0A161Y9K7.1
#=GS W9WD84_9EURO/496-601        AC W9WD84.1
#=GS A0A1J9R696_9EURO/411-518    AC A0A1J9R696.1
#=GS A0A101ME91_9EURO/1-78       AC A0A101ME91.1
#=GS A0A074YPM7_AURSE/306-384    AC A0A074YPM7.1
#=GS A0A1J9Q7U5_9EURO/563-703    AC A0A1J9Q7U5.1
#=GS A0A2C5YVS7_9HYPO/143-204    AC A0A2C5YVS7.1
#=GS A0A0D2FDQ0_9EURO/497-604    AC A0A0D2FDQ0.1
#=GS A0A0F8UEJ4_9EURO/530-673    AC A0A0F8UEJ4.1
#=GS S3CWZ7_OPHP1/661-722        AC S3CWZ7.1
#=GS A0A178E8Z5_9PLEO/580-633    AC A0A178E8Z5.1
#=GS A0A0C9MGZ4_9FUNG/278-317    AC A0A0C9MGZ4.1
#=GS M1W061_CLAP2/575-717        AC M1W061.1
#=GS A0A0D1XL11_9PEZI/537-689    AC A0A0D1XL11.1
#=GS A0A2V5HPZ2_ASPV1/554-688    AC A0A2V5HPZ2.1
#=GS A0A3N4M4W7_9PEZI/170-219    AC A0A3N4M4W7.1
#=GS A0A5J5EQA4_9PEZI/524-604    AC A0A5J5EQA4.1
#=GS G4N0D9_MAGO7/696-761        AC G4N0D9.1
#=GS G0SEH0_CHATD/522-587        AC G0SEH0.1
#=GS A0A2N3N5F7_9PEZI/600-650    AC A0A2N3N5F7.1
#=GS A0A3N2Q3M1_9PEZI/703-833    AC A0A3N2Q3M1.1
#=GS A0A0G2EJI4_9EURO/637-779    AC A0A0G2EJI4.1
#=GS A0A1Q5Q9J0_9EURO/479-625    AC A0A1Q5Q9J0.1
#=GS Q0UZC8_PHANO/537-676        AC Q0UZC8.2
#=GS A0A0B7N6U1_9FUNG/281-349    AC A0A0B7N6U1.1
#=GS A0A559LZI3_9HELO/493-635    AC A0A559LZI3.1
#=GS M1W061_CLAP2/430-517        AC M1W061.1
#=GS A0A3M6ZE02_HORWE/509-606    AC A0A3M6ZE02.1
#=GS A0A094JE74_9PEZI/406-494    AC A0A094JE74.1
#=GS A0A1L9PHY0_ASPVE/467-601    AC A0A1L9PHY0.1
#=GS A0A423VTZ9_9PEZI/565-711    AC A0A423VTZ9.1
#=GS A0A425BTC8_9PEZI/531-682    AC A0A425BTC8.1
#=GS A0A166MYR9_9PEZI/514-645    AC A0A166MYR9.1
#=GS A0A4Q3S325_9CAUL/2-146      AC A0A4Q3S325.1
#=GS A0A2I2FP96_9EURO/520-673    AC A0A2I2FP96.1
#=GS A0A4S3JBJ6_9EURO/368-472    AC A0A4S3JBJ6.1
#=GS G3JMF7_CORMM/459-600        AC G3JMF7.1
#=GS A0A4Q4Z1G4_9PEZI/387-447    AC A0A4Q4Z1G4.1
#=GS A0A3F3Q8Y6_9EURO/403-500    AC A0A3F3Q8Y6.1
#=GS M7SU52_EUTLA/643-785        AC M7SU52.1
#=GS H0EK30_GLAL7/414-499        AC H0EK30.1
#=GS A0A4V2RGI9_9ACTN/4-75       AC A0A4V2RGI9.1
#=GS A0A177D9J9_ALTAL/354-428    AC A0A177D9J9.1
#=GS A0A0G4PFU6_PENCA/547-696    AC A0A0G4PFU6.1
#=GS A0A2S7NRS5_9HELO/514-606    AC A0A2S7NRS5.1
#=GS A0A0J8RJW6_COCIT/382-491    AC A0A0J8RJW6.1
#=GS A0A0F4YIE0_TALEM/493-600    AC A0A0F4YIE0.1
#=GS A0A2D3UP02_9PEZI/307-348    AC A0A2D3UP02.1
#=GS A0A439DIZ4_9PEZI/407-474    AC A0A439DIZ4.1
#=GS A0A316VMK2_9BASI/62-125     AC A0A316VMK2.1
#=GS A0A0D2CID4_9EURO/495-604    AC A0A0D2CID4.1
#=GS A0A2B7XJD2_9EURO/398-518    AC A0A2B7XJD2.1
#=GS A2QKM3_ASPNC/301-373        AC A2QKM3.1
#=GS A0A4S3JBJ6_9EURO/519-651    AC A0A4S3JBJ6.1
#=GS C4JEK8_UNCRE/550-601        AC C4JEK8.1
#=GS A0A0D2E8L9_9EURO/496-603    AC A0A0D2E8L9.1
#=GS A0A1J7I7S3_9PEZI/685-756    AC A0A1J7I7S3.1
#=GS A0A2U1MVF2_ARTAN/209-282    AC A0A2U1MVF2.1
#=GS A0A168JB54_MUCCL/900-942    AC A0A168JB54.1
#=GS A0A395I4D9_ASPHC/298-360    AC A0A395I4D9.1
#=GS G2QTJ0_THETT/700-864        AC G2QTJ0.1
#=GS E9DDF0_COCPS/510-672        AC E9DDF0.1
#=GS U7PSX9_SPOS1/496-646        AC U7PSX9.1
#=GS W6XRN4_COCCA/345-431        AC W6XRN4.1
#=GS A0A370TQE2_9HELO/496-572    AC A0A370TQE2.1
#=GS S3DTS4_GLAL2/454-537        AC S3DTS4.1
#=GS B6H242_PENRW/542-687        AC B6H242.1
#=GS A0A135U1E0_9PEZI/645-691    AC A0A135U1E0.1
#=GS A0A1J9SBG8_9PEZI/458-590    AC A0A1J9SBG8.1
#=GS A0A6P8BFX7_MAGGR/488-540    AC A0A6P8BFX7.1
#=GS S3DTS4_GLAL2/755-867        AC S3DTS4.1
#=GS A0A2T2NGB3_CORCC/452-534    AC A0A2T2NGB3.1
#=GS A0A059J342_TRIIM/567-700    AC A0A059J342.1
#=GS A0A0D1Z4Z7_9EURO/479-597    AC A0A0D1Z4Z7.1
#=GS A0A1Y2EBN1_9PEZI/495-556    AC A0A1Y2EBN1.1
#=GS A0A1B8CI28_9PEZI/513-651    AC A0A1B8CI28.1
#=GS A0A179F7R8_METCM/464-564    AC A0A179F7R8.1
#=GS A0A673LV53_9TELE/292-416    AC A0A673LV53.1
#=GS K9FWG0_PEND2/304-377        AC K9FWG0.1
#=GS A0A0F4GXD0_9PEZI/303-351    AC A0A0F4GXD0.1
#=GS A0A074WG27_9PEZI/325-402    AC A0A074WG27.1
#=GS A2QKM3_ASPNC/397-504        AC A2QKM3.1
#=GS A0A1B8ESY3_9PEZI/555-711    AC A0A1B8ESY3.1
#=GS A0A1S8B208_9PEZI/590-641    AC A0A1S8B208.1
#=GS A0A1L7X6W7_9HELO/641-789    AC A0A1L7X6W7.1
#=GS A0A484G583_COLOR/53-173     AC A0A484G583.1
#=GS S2JHI7_MUCC1/200-279        AC S2JHI7.1
#=GS A0A2K1R052_9PEZI/612-761    AC A0A2K1R052.1
#=GS W9XB18_9EURO/486-592        AC W9XB18.1
#=GS A0A2J6QGU0_9HELO/512-601    AC A0A2J6QGU0.1
#=GS A0A1G4B989_9PEZI/512-640    AC A0A1G4B989.1
#=GS W9XLQ4_9EURO/630-790        AC W9XLQ4.1
#=GS M2ZPK6_PSEFD/811-967        AC M2ZPK6.1
#=GS A0A4T0VLI6_9PEZI/626-669    AC A0A4T0VLI6.1
#=GS A0A2S6CI98_9PEZI/665-829    AC A0A2S6CI98.1
#=GS E5AFM9_LEPMJ/591-727        AC E5AFM9.1
#=GS A0A1V6TKK6_9EURO/714-790    AC A0A1V6TKK6.1
#=GS A0A094JE74_9PEZI/550-621    AC A0A094JE74.1
#=GS G3JMF7_CORMM/325-456        AC G3JMF7.1
#=GS A0A2I2G2G6_9EURO/531-669    AC A0A2I2G2G6.1
#=GS A0A5N6TGK4_9EURO/367-471    AC A0A5N6TGK4.1
#=GS M7U351_BOTF1/694-842        AC M7U351.1
#=GS S2JHI7_MUCC1/359-418        AC S2JHI7.1
#=GS A0A1B7P428_9EURO/371-480    AC A0A1B7P428.1
#=GS C1GDB7_PARBD/373-473        AC C1GDB7.2
#=GS A0A5N5K296_9PEZI/559-701    AC A0A5N5K296.1
#=GS W9XLQ4_9EURO/485-605        AC W9XLQ4.1
#=GS W9W1E3_9EURO/534-675        AC W9W1E3.1
#=GS U7PSX9_SPOS1/670-732        AC U7PSX9.1
#=GS A0A1C1CLL1_9EURO/643-802    AC A0A1C1CLL1.1
#=GS A0A1L9MUX9_ASPTC/302-372    AC A0A1L9MUX9.1
#=GS A0A2D3UP02_9PEZI/643-800    AC A0A2D3UP02.1
#=GS A0A319A1B2_9EURO/268-329    AC A0A319A1B2.1
#=GS A0A072PTE1_9EURO/632-778    AC A0A072PTE1.1
#=GS A0A0N0NRB6_9EURO/461-591    AC A0A0N0NRB6.1
#=GS A0A2P7ZDN6_9PEZI/383-456    AC A0A2P7ZDN6.1
#=GS A0A136J136_9PEZI/665-772    AC A0A136J136.1
#=GS G4N0D9_MAGO7/539-644        AC G4N0D9.1
#=GS A0A4Q4WVB9_9PEZI/560-619    AC A0A4Q4WVB9.1
#=GS A0A5N6FP34_PETAA/529-576    AC A0A5N6FP34.1
#=GS A0A5N7BNB9_9EURO/416-515    AC A0A5N7BNB9.1
#=GS A0A080WQ72_TRIRC/489-609    AC A0A080WQ72.1
#=GS A0A074YPM7_AURSE/540-696    AC A0A074YPM7.1
#=GS A0A5N6TGK4_9EURO/520-656    AC A0A5N6TGK4.1
#=GS G2QTJ0_THETT/535-639        AC G2QTJ0.1
#=GS A0A139HNL3_9PEZI/431-506    AC A0A139HNL3.1
#=GS A0A5N5XDY5_9EURO/553-690    AC A0A5N5XDY5.1
#=GS A0A2P7ZDN6_9PEZI/610-758    AC A0A2P7ZDN6.1
#=GS A0A7C8MR54_9PEZI/397-464    AC A0A7C8MR54.1
#=GS A0A168JB54_MUCCL/191-228    AC A0A168JB54.1
#=GS A0A319DWF9_9EURO/371-468    AC A0A319DWF9.1
#=GS A0A136J136_9PEZI/486-567    AC A0A136J136.1
#=GS E3QDR6_COLGM/691-829        AC E3QDR6.1
#=GS S2K5A6_MUCC1/218-326        AC S2K5A6.1
#=GS A0A5N6EDR8_9EURO/306-377    AC A0A5N6EDR8.1
#=GS A7EI77_SCLS1/616-790        AC A7EI77.1
#=GS A0A364L5S8_9EURO/478-621    AC A0A364L5S8.1
#=GS A0A507QN43_MONPU/297-352    AC A0A507QN43.1
#=GS M2MVN7_BAUPA/433-520        AC M2MVN7.1
#=GS A0A0D2DS24_9EURO/379-467    AC A0A0D2DS24.1
#=GS B6Q8Z7_TALMQ/499-641        AC B6Q8Z7.1
#=GS W3XH82_PESFW/412-479        AC W3XH82.1
#=GS A0A3N2Q3M1_9PEZI/652-711    AC A0A3N2Q3M1.1
#=GS F0U958_AJEC8/562-700        AC F0U958.1
#=GS A0A2V1C4F1_9HELO/626-771    AC A0A2V1C4F1.1
#=GS A0A1F7ZZU3_9EURO/563-614    AC A0A1F7ZZU3.1
#=GS A0A5M9JK00_MONFR/761-880    AC A0A5M9JK00.1
#=GS W2RLM0_9EURO/664-811        AC W2RLM0.1
#=GS A0A395GJ13_9EURO/404-506    AC A0A395GJ13.1
#=GS A0A1B7P428_9EURO/268-337    AC A0A1B7P428.1
#=GS A0A1L9MUX9_ASPTC/555-694    AC A0A1L9MUX9.1
#=GS A0A1J9Q7U5_9EURO/412-520    AC A0A1J9Q7U5.1
#=GS A0A2J6SZQ0_9HELO/569-699    AC A0A2J6SZQ0.1
#=GS A0A1F5LN85_9EURO/546-695    AC A0A1F5LN85.1
#=GS A0A5N6Z5V7_9EURO/526-665    AC A0A5N6Z5V7.1
#=GS A0A0A2KDD1_PENIT/540-687    AC A0A0A2KDD1.1
#=GS A0A167RTY9_9PEZI/701-763    AC A0A167RTY9.1
#=GS A0A1Y2LKH8_EPING/366-430    AC A0A1Y2LKH8.1
#=GS W9W1E3_9EURO/364-467        AC W9W1E3.1
#=GS A0A0J8QS49_COCIT/156-318    AC A0A0J8QS49.1
#=GS A0A4Z1KTP7_9HELO/548-651    AC A0A4Z1KTP7.1
#=GS A0A6G1FTE2_9PEZI/345-413    AC A0A6G1FTE2.1
#=GS A0A1V6NZN5_PENDC/522-668    AC A0A1V6NZN5.1
#=GS A0A3M6ZE02_HORWE/347-405    AC A0A3M6ZE02.1
#=GS A0A319DBM7_9EURO/302-372    AC A0A319DBM7.1
#=GS A0A4R8QR31_COLTR/691-813    AC A0A4R8QR31.1
#=GS A0A1C1CTM8_9EURO/536-677    AC A0A1C1CTM8.1
#=GS A0A5N6Z5V7_9EURO/380-479    AC A0A5N6Z5V7.1
#=GS T0KDB4_COLGC/456-501        AC T0KDB4.1
#=GS A0A166MYR9_9PEZI/646-698    AC A0A166MYR9.1
#=GS A0A168JB54_MUCCL/709-750    AC A0A168JB54.1
#=GS R7YPI0_CONA1/593-724        AC R7YPI0.1
#=GS A0A1Z5TUU8_HORWE/634-802    AC A0A1Z5TUU8.1
#=GS A0A5N7DNY0_9EURO/563-606    AC A0A5N7DNY0.1
#=GS A0A0K8LFQ8_9EURO/522-657    AC A0A0K8LFQ8.1
#=GS A0A395I4D9_ASPHC/397-494    AC A0A395I4D9.1
#=GS A6RCP1_AJECN/417-528        AC A6RCP1.1
#=GS A0A1Y2V118_9PEZI/70-250     AC A0A1Y2V118.1
#=GS A0A1V6TAM2_9EURO/158-218    AC A0A1V6TAM2.1
#=GS A0A2V1D6T8_9PLEO/437-515    AC A0A2V1D6T8.1
#=GS A0A443HVL7_BYSSP/558-701    AC A0A443HVL7.1
#=GS A0A5N5XDY5_9EURO/295-358    AC A0A5N5XDY5.1
#=GS H6C6Y6_EXODN/485-594        AC H6C6Y6.1
#=GS A0A232LTH9_9EURO/539-687    AC A0A232LTH9.1
#=GS A0A1S8B208_9PEZI/348-428    AC A0A1S8B208.1
#=GS A6RCP1_AJECN/562-700        AC A6RCP1.1
#=GS B6HIZ7_PENRW/640-721        AC B6HIZ7.1
#=GS A0A7D8YMR6_9HELO/529-626    AC A0A7D8YMR6.1
#=GS K1WW28_MARBU/694-854        AC K1WW28.1
#=GS A1DGB5_NEOFI/538-673        AC A1DGB5.1
#=GS A0A168JB54_MUCCL/358-432    AC A0A168JB54.1
#=GS A0A0D1XL02_EXOME/427-575    AC A0A0D1XL02.1
#=GS A0A178ET40_TRIRU/565-700    AC A0A178ET40.1
#=GS B8M1D8_TALSN/481-624        AC B8M1D8.1
#=GS A0A4Q4WLE6_9PEZI/653-703    AC A0A4Q4WLE6.1
#=GS A0A1Z5TUU8_HORWE/347-404    AC A0A1Z5TUU8.1
#=GS A0A066XKL1_COLSU/654-716    AC A0A066XKL1.1
#=GS A0A4Z1P1V0_9PEZI/599-748    AC A0A4Z1P1V0.1
#=GS A0A4Y8D0A2_9HELO/694-849    AC A0A4Y8D0A2.1
#=GS A0A3E2GRF7_SCYLI/582-728    AC A0A3E2GRF7.1
#=GS A0A2J6Q4H2_9HELO/30-143     AC A0A2J6Q4H2.1
#=GS U6KG47_9EIME/184-288        AC U6KG47.1
#=GS A0A553HVQ4_9PEZI/648-779    AC A0A553HVQ4.1
#=GS A0A425BSJ7_9PEZI/369-421    AC A0A425BSJ7.1
#=GS A0A2J6S1J8_9HELO/531-618    AC A0A2J6S1J8.1
#=GS A0A1V8UUF7_9PEZI/644-823    AC A0A1V8UUF7.1
#=GS G4N0D9_MAGO7/486-540        AC G4N0D9.1
#=GS A0A5N6D9T0_ASPPA/304-377    AC A0A5N6D9T0.1
#=GS W6PSX9_PENRF/699-813        AC W6PSX9.1
#=GS A0A074YSE8_AURPU/553-710    AC A0A074YSE8.1
#=GS A0A136J136_9PEZI/620-688    AC A0A136J136.1
#=GS A0A0D2FDQ0_9EURO/644-803    AC A0A0D2FDQ0.1
#=GS A0A179UYF2_BLAGS/340-447    AC A0A179UYF2.1
#=GS A0A178AVN6_9PLEO/350-419    AC A0A178AVN6.1
#=GS S2JHI7_MUCC1/417-457        AC S2JHI7.1
#=GS A0A1B8CI28_9PEZI/320-381    AC A0A1B8CI28.1
#=GS A0A4R8QR31_COLTR/633-702    AC A0A4R8QR31.1
#=GS A0A2H3IUL2_9EURO/478-621    AC A0A2H3IUL2.1
#=GS A0A0U5FQN0_9EURO/276-337    AC A0A0U5FQN0.1
#=GS A0A072PTE1_9EURO/475-588    AC A0A072PTE1.1
#=GS A0A1J7I7S3_9PEZI/751-888    AC A0A1J7I7S3.1
#=GS A0A5M9JNN2_MONFR/733-861    AC A0A5M9JNN2.1
#=GS G7XHH0_ASPKW/557-696        AC G7XHH0.1
#=GS B8NBW3_ASPFN/304-375        AC B8NBW3.1
#=GS A0A1V6TKK6_9EURO/587-692    AC A0A1V6TKK6.1
#=GS A1CSM6_ASPCL/533-664        AC A1CSM6.1
#=GS W2RLM0_9EURO/515-654        AC W2RLM0.1
#=GS A0A194X7G0_9HELO/505-597    AC A0A194X7G0.1
#=GS A0A1L9U746_ASPBC/554-699    AC A0A1L9U746.1
#=GS S3CWZ7_OPHP1/493-635        AC S3CWZ7.1
#=GS G3XV77_ASPNA/397-504        AC G3XV77.1
#=GS A0A0D2K9Q9_9EURO/624-785    AC A0A0D2K9Q9.1
#=GS A0A2T3BE08_AMORE/628-675    AC A0A2T3BE08.1
#=GS A0A5N7BNB9_9EURO/306-381    AC A0A5N7BNB9.1
#=GS A0A3N4L4M6_9PEZI/412-474    AC A0A3N4L4M6.1
#=GS A0A319A1B2_9EURO/368-466    AC A0A319A1B2.1
#=GS W9Y839_9EURO/372-454        AC W9Y839.1
#=GS A0A0U1M4K8_TALIS/257-321    AC A0A0U1M4K8.1
#=GS H1UXZ2_COLHI/511-639        AC H1UXZ2.1
#=GS A0A395I4D9_ASPHC/546-673    AC A0A395I4D9.1
#=GS A0A397HWZ0_9EURO/515-646    AC A0A397HWZ0.1
#=GS A0A1L9STT0_9EURO/426-521    AC A0A1L9STT0.1
#=GS A0A161Y9K7_9PEZI/741-876    AC A0A161Y9K7.1
#=GS A0A1Y2A0R4_9PLEO/469-563    AC A0A1Y2A0R4.1
#=GS A0A0F7TW88_PENBI/493-640    AC A0A0F7TW88.1
#=GS A0A168JB54_MUCCL/525-568    AC A0A168JB54.1
#=GS A0A1Z5TUU8_HORWE/396-483    AC A0A1Z5TUU8.1
#=GS A0A2T3AHR6_9PEZI/581-654    AC A0A2T3AHR6.1
#=GS A0A401L9C1_ASPAW/398-506    AC A0A401L9C1.1
#=GS Q0C9I2_ASPTN/392-495        AC Q0C9I2.1
#=GS A0A7D8YMR6_9HELO/425-500    AC A0A7D8YMR6.1
#=GS A0A3A2ZU51_9EURO/400-495    AC A0A3A2ZU51.1
#=GS A0A1J7I7S3_9PEZI/530-641    AC A0A1J7I7S3.1
#=GS A0A5M9JK00_MONFR/716-767    AC A0A5M9JK00.1
#=GS A0A166V6M7_9HYPO/597-735    AC A0A166V6M7.1
#=GS A0A2H3IUL2_9EURO/254-310    AC A0A2H3IUL2.1
#=GS A0A4U0V3S5_9PEZI/716-888    AC A0A4U0V3S5.1
#=GS M2MVN7_BAUPA/647-824        AC M2MVN7.1
#=GS A0A2K1R052_9PEZI/393-468    AC A0A2K1R052.1
#=GS A0A0S6X889_9FUNG/464-554    AC A0A0S6X889.1
#=GS A0A7C8MR54_9PEZI/609-789    AC A0A7C8MR54.1
#=GS A0A317V8F6_9EURO/400-501    AC A0A317V8F6.1
#=GS A0A084G042_PSEDA/617-801    AC A0A084G042.1
#=GS D4AU90_ARTBC/558-692        AC D4AU90.1
#=GS A0A0U5FQN0_9EURO/517-650    AC A0A0U5FQN0.1
#=GS A0A0B7N6U1_9FUNG/214-285    AC A0A0B7N6U1.1
#=GS A0A0G4LM95_9PEZI/435-530    AC A0A0G4LM95.1
#=GS A0A2B7Y2U2_9EURO/280-347    AC A0A2B7Y2U2.1
#=GS A0A0G2EJI4_9EURO/389-457    AC A0A0G2EJI4.1
#=GS A0A093Y5R9_9PEZI/922-999    AC A0A093Y5R9.1
#=GS A0A1V6NZN5_PENDC/392-484    AC A0A1V6NZN5.1
#=GS A0A0F0I0U5_ASPPU/306-380    AC A0A0F0I0U5.1
#=GS A0A7C8IEV6_9PLEO/593-730    AC A0A7C8IEV6.1
#=GS A0A559LZI3_9HELO/269-339    AC A0A559LZI3.1
#=GS A0A0D1Z4Z7_9EURO/364-449    AC A0A0D1Z4Z7.1
#=GS G9PCA8_HYPAI/432-520        AC G9PCA8.1
#=GS A0A010Q3X1_9PEZI/517-646    AC A0A010Q3X1.1
#=GS W6PSX9_PENRF/493-646        AC W6PSX9.1
#=GS C8V000_EMENI/27-137         AC C8V000.1
#=GS A0A100ITS5_ASPNG/555-694    AC A0A100ITS5.1
#=GS B5YNX8_THAPS/64-186         AC B5YNX8.1
#=GS A0A319EH32_ASPSB/547-685    AC A0A319EH32.1
#=GS M2ZPK6_PSEFD/581-658        AC M2ZPK6.1
#=GS A0A4Q4WVB9_9PEZI/471-558    AC A0A4Q4WVB9.1
#=GS A0A5N6D9T0_ASPPA/563-702    AC A0A5N6D9T0.1
#=GS A0A2V1C4F1_9HELO/493-586    AC A0A2V1C4F1.1
#=GS A0A1L9U746_ASPBC/303-374    AC A0A1L9U746.1
#=GS A0A2S7QP56_9HELO/649-810    AC A0A2S7QP56.1
#=GS K2S5L1_MACPH/454-539        AC K2S5L1.1
#=GS A0A4Z1KTP7_9HELO/693-847    AC A0A4Z1KTP7.1
#=GS A0A5N5M5Y0_PANHP/468-580    AC A0A5N5M5Y0.1
#=GS A0A1L9TGA8_9EURO/329-460    AC A0A1L9TGA8.1
#=GS Q2TZD9_ASPOR/411-515        AC Q2TZD9.1
#=GS A0A484G7Z2_COLOR/501-563    AC A0A484G7Z2.1
#=GS E3QDR6_COLGM/644-698        AC E3QDR6.1
#=GS A0A100ITS5_ASPNG/302-372    AC A0A100ITS5.1
#=GS A0A5N6ZL79_9EURO/412-514    AC A0A5N6ZL79.1
#=GS A0A0D2I679_9EURO/641-794    AC A0A0D2I679.1
#=GS A0A0D2DS24_9EURO/497-604    AC A0A0D2DS24.1
#=GS A0A1Y2VW00_9PEZI/495-570    AC A0A1Y2VW00.1
#=GS Q0C9I2_ASPTN/537-583        AC Q0C9I2.1
#=GS A0A364L5S8_9EURO/311-353    AC A0A364L5S8.1
#=GS A0A1S9DDZ8_ASPOZ/561-699    AC A0A1S9DDZ8.1
#=GS A0A5M9JLR0_MONFR/761-889    AC A0A5M9JLR0.1
#=GS A0A010Q3X1_9PEZI/698-843    AC A0A010Q3X1.1
#=GS A0A5N6K0E4_9HELO/704-828    AC A0A5N6K0E4.1
#=GS A0A0F0I0U5_ASPPU/563-702    AC A0A0F0I0U5.1
#=GS G7XHH0_ASPKW/302-375        AC G7XHH0.1
#=GS A0A139HNL3_9PEZI/658-816    AC A0A139HNL3.1
#=GS A0A3F3Q8Y6_9EURO/302-374    AC A0A3F3Q8Y6.1
#=GS G0SEH0_CHATD/691-755        AC G0SEH0.1
#=GS U1HT54_ENDPU/646-826        AC U1HT54.1
#=GS J3KI03_COCIM/382-492        AC J3KI03.2
#=GS A0A2T3BE08_AMORE/494-596    AC A0A2T3BE08.1
#=GS A0A1Y2EBN1_9PEZI/760-910    AC A0A1Y2EBN1.1
#=GS A0A1V8SPN9_9PEZI/512-687    AC A0A1V8SPN9.1
#=GS A0A395GJ13_9EURO/556-694    AC A0A395GJ13.1
#=GS A0A1V6RRE2_9EURO/539-691    AC A0A1V6RRE2.1
#=GS A0A1L9R783_ASPWE/528-674    AC A0A1L9R783.1
#=GS A0A168JB54_MUCCL/450-482    AC A0A168JB54.1
#=GS A0A0D2BWC7_9EURO/364-449    AC A0A0D2BWC7.1
#=GS G2WRI8_VERDV/647-805        AC G2WRI8.1
#=GS A0A094DD18_9PEZI/514-649    AC A0A094DD18.1
#=GS A0A3N4L4M6_9PEZI/358-416    AC A0A3N4L4M6.1
#=GS A0A4U0V4Y7_9PEZI/680-839    AC A0A4U0V4Y7.1
#=GS B8M1D8_TALSN/257-313        AC B8M1D8.1
#=GS A0A0A2V7C7_BEABA/446-520    AC A0A0A2V7C7.1
#=GS K2S5L1_MACPH/347-423        AC K2S5L1.1
#=GS A0A0A2K6U1_PENEN/544-693    AC A0A0A2K6U1.1
#=GS A0A0D2CID4_9EURO/644-804    AC A0A0D2CID4.1
#=GS A0A1L9MUX9_ASPTC/401-507    AC A0A1L9MUX9.1
#=GS A0A136J136_9PEZI/386-450    AC A0A136J136.1
#=GS A0A6H0XNR0_9PEZI/633-776    AC A0A6H0XNR0.1
#=GS A0A0L1J2N0_ASPNO/304-377    AC A0A0L1J2N0.1
#=GS A0A1Y2X697_9PEZI/67-240     AC A0A1Y2X697.1
#=GS A0A443HVL7_BYSSP/411-511    AC A0A443HVL7.1
#=GS A0A1V6NZN5_PENDC/286-351    AC A0A1V6NZN5.1
#=GS A0A1Y2VW00_9PEZI/395-459    AC A0A1Y2VW00.1
#=GS A0A166MYR9_9PEZI/691-854    AC A0A166MYR9.1
#=GS A0A1L9U746_ASPBC/402-508    AC A0A1L9U746.1
#=GS A0A2I2FP96_9EURO/293-350    AC A0A2I2FP96.1
#=GS A0A1V8U041_9PEZI/19-102     AC A0A1V8U041.1
#=GS A0A1F7ZZU3_9EURO/412-516    AC A0A1F7ZZU3.1
#=GS A0A7H8QYA3_9EURO/497-639    AC A0A7H8QYA3.1
#=GS A0A319DBM7_9EURO/390-486    AC A0A319DBM7.1
#=GS A0A401L9C1_ASPAW/302-373    AC A0A401L9C1.1
#=GS A0A4T0VLI6_9PEZI/669-808    AC A0A4T0VLI6.1
#=GS A0A178ZW35_9EURO/478-585    AC A0A178ZW35.1
#=GS A0A3M2T023_9EURO/337-438    AC A0A3M2T023.1
#=GS A0A0M8P4S7_9EURO/502-653    AC A0A0M8P4S7.1
#=GS A0A084G042_PSEDA/487-604    AC A0A084G042.1
#=GS A0A0D1XL11_9PEZI/419-472    AC A0A0D1XL11.1
#=GS A0A317X6X5_9EURO/553-685    AC A0A317X6X5.1
#=GS S3CWZ7_OPHP1/711-838        AC S3CWZ7.1
#=GS A0A5N6FP34_PETAA/381-483    AC A0A5N6FP34.1
#=GS S7ZET0_PENO1/503-650        AC S7ZET0.1
#=GS R8BUE6_TOGMI/691-750        AC R8BUE6.1
#=GS C6HTC0_AJECH/453-591        AC C6HTC0.1
#=GS A0A6A6YH16_9PEZI/575-721    AC A0A6A6YH16.1
#=GS A0A074W448_9PEZI/322-398    AC A0A074W448.1
#=GS A0A6P8BFX7_MAGGR/692-768    AC A0A6P8BFX7.1
#=GS B8NBW3_ASPFN/412-514        AC B8NBW3.1
#=GS A0A1B8GNS0_9PEZI/404-488    AC A0A1B8GNS0.1
#=GS A0A1V1TG51_9FUNG/634-810    AC A0A1V1TG51.1
#=GS A0A074WG27_9PEZI/559-713    AC A0A074WG27.1
#=GS W6XRN4_COCCA/587-743        AC W6XRN4.1
#=GS A0A1L9RA18_ASPWE/354-461    AC A0A1L9RA18.1
#=GS A0A093YVZ9_9PEZI/8-61       AC A0A093YVZ9.1
#=GS A0A517LRB0_9PEZI/589-738    AC A0A517LRB0.1
#=GS A0A3E2GRF7_SCYLI/440-517    AC A0A3E2GRF7.1
#=GS E9DDF0_COCPS/348-390        AC E9DDF0.1
#=GS H1UXZ2_COLHI/641-843        AC H1UXZ2.1
#=GS A0A2G7FKH8_9EURO/556-603    AC A0A2G7FKH8.1
#=GS A0A3F3Q8Y6_9EURO/557-696    AC A0A3F3Q8Y6.1
#=GS A0A0A1TGS9_9HYPO/445-522    AC A0A0A1TGS9.1
#=GS A0A7C8IEV6_9PLEO/473-549    AC A0A7C8IEV6.1
#=GS A0A0D2CBM0_9EURO/653-807    AC A0A0D2CBM0.1
#=GS A0A1Z5TUU8_HORWE/508-605    AC A0A1Z5TUU8.1
#=GS N1PM89_DOTSN/650-820        AC N1PM89.1
#=GS A0A3D8SX48_9EURO/295-355    AC A0A3D8SX48.1
#=GS A0A319EH32_ASPSB/301-366    AC A0A319EH32.1
#=GS A0A168JB54_MUCCL/840-902    AC A0A168JB54.1
#=GS A0A178AVN6_9PLEO/458-640    AC A0A178AVN6.1
#=GS A0A161Y9K7_9PEZI/566-695    AC A0A161Y9K7.1
#=GS C8V000_EMENI/175-307        AC C8V000.1
#=GS A0A420YNZ3_9PEZI/515-557    AC A0A420YNZ3.1
#=GS A0A1W2TCT9_ROSNE/488-564    AC A0A1W2TCT9.1
#=GS A0A5J5EQA4_9PEZI/339-391    AC A0A5J5EQA4.1
#=GS A0A1V8U041_9PEZI/258-435    AC A0A1V8U041.1
#=GS A0A1F7ZZU3_9EURO/304-375    AC A0A1F7ZZU3.1
#=GS A0A2N6NHF3_BEABA/446-518    AC A0A2N6NHF3.1
#=GS A0A229X8A5_9EURO/272-336    AC A0A229X8A5.1
#=GS W3XH82_PESFW/247-324        AC W3XH82.1
#=GS A0A364L5S8_9EURO/256-309    AC A0A364L5S8.1
#=GS E9E4W9_METAQ/460-561        AC E9E4W9.1
#=GS A0A2I0SMB1_9ACTN/4-73       AC A0A2I0SMB1.1
#=GS A0A1J9SBG8_9PEZI/594-754    AC A0A1J9SBG8.1
#=GS A0A229X8A5_9EURO/515-648    AC A0A229X8A5.1
#=GS F9XE98_ZYMTI/399-476        AC F9XE98.1
#=GS A0A0D2CBM0_9EURO/501-610    AC A0A0D2CBM0.1
#=GS A0A0U1M4K8_TALIS/488-632    AC A0A0U1M4K8.1
#=GS A0A0L1J2N0_ASPNO/527-588    AC A0A0L1J2N0.1
#=GS A0A6H0XNR0_9PEZI/413-491    AC A0A6H0XNR0.1
#=GS A0A0D2DS24_9EURO/644-801    AC A0A0D2DS24.1
#=GS A0A3D8Q8W0_9HELO/489-582    AC A0A3D8Q8W0.1
#=GS C4JEK8_UNCRE/306-416        AC C4JEK8.1
#=GS A0A5N7DNY0_9EURO/304-379    AC A0A5N7DNY0.1
#=GS A0A0S7DWY3_9EURO/522-657    AC A0A0S7DWY3.1
#=GS A0A0D2DIH2_9EURO/629-789    AC A0A0D2DIH2.1
#=GS A0A1V6QNL3_9EURO/540-689    AC A0A1V6QNL3.1
#=GS C1GDB7_PARBD/522-661        AC C1GDB7.2
#=GS A0A2J6S1J8_9HELO/273-333    AC A0A2J6S1J8.1
#=GS C5G976_AJEDR/468-605        AC C5G976.2
#=GS A0A370TQE2_9HELO/460-505    AC A0A370TQE2.1
#=GS A0A166V6M7_9HYPO/454-553    AC A0A166V6M7.1
#=GS A0A163HMV4_DIDRA/593-755    AC A0A163HMV4.1
#=GS A0A2J6S1J8_9HELO/658-792    AC A0A2J6S1J8.1
#=GS F7W3Z0_SORMK/764-824        AC F7W3Z0.1
#=GS A0A0D2K9Q9_9EURO/477-584    AC A0A0D2K9Q9.1
#=GS A0A3N4L4M6_9PEZI/199-262    AC A0A3N4L4M6.1
#=GS A0A2G7FKH8_9EURO/504-560    AC A0A2G7FKH8.1
#=GS A0A4U6XQ92_9PEZI/687-829    AC A0A4U6XQ92.1
#=GS R0K5Y5_SETT2/335-402        AC R0K5Y5.1
#=GS A0A6A6YH16_9PEZI/353-423    AC A0A6A6YH16.1
#=GS A0A319EH32_ASPSB/402-504    AC A0A319EH32.1
#=GS Q2TZD9_ASPOR/304-373        AC Q2TZD9.1
#=GS A0A3M6ZE02_HORWE/397-485    AC A0A3M6ZE02.1
#=GS A0A423VTZ9_9PEZI/527-571    AC A0A423VTZ9.1
#=GS A0A425BSJ7_9PEZI/573-718    AC A0A425BSJ7.1
#=GS A0A5M9JNN2_MONFR/689-740    AC A0A5M9JNN2.1
#=GS M3CFH9_SPHMS/662-825        AC M3CFH9.1
#=GS A0A317V8F6_9EURO/551-689    AC A0A317V8F6.1
#=GS T0KDB4_COLGC/499-614        AC T0KDB4.1
#=GS B8M1D8_TALSN/314-354        AC B8M1D8.1
#=GS A0A1Y2VW00_9PEZI/310-396    AC A0A1Y2VW00.1
#=GS A0A4Z0YIZ2_9PEZI/405-477    AC A0A4Z0YIZ2.1
#=GS A0A6P8BFX7_MAGGR/539-647    AC A0A6P8BFX7.1
#=GS A0A2V5HPZ2_ASPV1/402-502    AC A0A2V5HPZ2.1
#=GS A0A1V6T2E2_9EURO/552-703    AC A0A1V6T2E2.1
#=GS A0A084G042_PSEDA/442-486    AC A0A084G042.1
#=GS A0A319DBM7_9EURO/542-670    AC A0A319DBM7.1
#=GS A0A0D2DIH2_9EURO/370-453    AC A0A0D2DIH2.1
#=GS A1DGB5_NEOFI/392-493        AC A1DGB5.1
#=GS A0A5N6UXE2_9EURO/566-609    AC A0A5N6UXE2.1
#=GS A0A4S3JBJ6_9EURO/272-343    AC A0A4S3JBJ6.1
#=GS A0A3M2T023_9EURO/244-303    AC A0A3M2T023.1
#=GS W9Y839_9EURO/636-791        AC W9Y839.1
#=GS A0A439DIZ4_9PEZI/500-561    AC A0A439DIZ4.1
#=GS A0A063BU25_USTVR/461-568    AC A0A063BU25.1
#=GS S7ZET0_PENO1/261-334        AC S7ZET0.1
#=GS A0A1Y2EBN1_9PEZI/712-769    AC A0A1Y2EBN1.1
#=GS A0A1V6XYP1_PENNA/696-771    AC A0A1V6XYP1.1
#=GS A0A1L9R783_ASPWE/382-487    AC A0A1L9R783.1
#=GS Q0C9I2_ASPTN/296-361        AC Q0C9I2.1
#=GS B8NBW3_ASPFN/561-699        AC B8NBW3.1
#=GS A1CSM6_ASPCL/293-357        AC A1CSM6.1
#=GS E9DDF0_COCPS/287-350        AC E9DDF0.1
#=GS A0A2I2FP96_9EURO/386-501    AC A0A2I2FP96.1
#=GS A0A093Y5R9_9PEZI/1015-1087  AC A0A093Y5R9.1
#=GS A0A6A4K4H7_APOLU/128-259    AC A0A6A4K4H7.1
#=GS B6Q8Z7_TALMQ/273-331        AC B6Q8Z7.1
#=GS C4JEK8_UNCRE/432-491        AC C4JEK8.1
#=GS A0A1B9FV19_9TREE/1-73       AC A0A1B9FV19.1
#=GS C1HCJ5_PARBA/372-473        AC C1HCJ5.2
#=GS A0A0D9NRE2_METAN/458-561    AC A0A0D9NRE2.1
#=GS A0A4Q4Z1G4_9PEZI/473-553    AC A0A4Q4Z1G4.1
#=GS A0A507QN43_MONPU/389-509    AC A0A507QN43.1
#=GS A0A066XKL1_COLSU/488-525    AC A0A066XKL1.1
#=GS A0A2S6CI98_9PEZI/562-653    AC A0A2S6CI98.1
#=GS A0A6P8BFX7_MAGGR/757-890    AC A0A6P8BFX7.1
#=GS A0A3M2T023_9EURO/454-580    AC A0A3M2T023.1
#=GS A0A2B7XJD2_9EURO/551-701    AC A0A2B7XJD2.1
#=GS S2JHI7_MUCC1/469-529        AC S2JHI7.1
#=GS A0A0D2APJ8_9EURO/500-608    AC A0A0D2APJ8.1
#=GS A0A5N6UXE2_9EURO/305-381    AC A0A5N6UXE2.1
#=GS A0A2B7Y2U2_9EURO/521-656    AC A0A2B7Y2U2.1
#=GS A0A4Q4TAA7_9PEZI/548-607    AC A0A4Q4TAA7.1
#=GS A0A5N5K296_9PEZI/713-790    AC A0A5N5K296.1
#=GS K2S5L1_MACPH/581-741        AC K2S5L1.1
#=GS A0A5N6EDR8_9EURO/563-702    AC A0A5N6EDR8.1
#=GS W9XLQ4_9EURO/374-457        AC W9XLQ4.1
#=GS A0A218ZBI5_9HELO/492-578    AC A0A218ZBI5.1
#=GS A0A1L9X4X7_ASPA1/272-333    AC A0A1L9X4X7.1
#=GS A0A0D1ZLV8_EXOME/395-477    AC A0A0D1ZLV8.1
#=GS A0A5N5DQ18_9PEZI/586-746    AC A0A5N5DQ18.1
#=GS A0A0F8UEJ4_9EURO/277-347    AC A0A0F8UEJ4.1
#=GS W9XB18_9EURO/633-819        AC W9XB18.1
#=GS A0A4U0V3S5_9PEZI/482-561    AC A0A4U0V3S5.1
#=GS A0A439DIZ4_9PEZI/623-798    AC A0A439DIZ4.1
#=GS A0A0B7N6U1_9FUNG/109-176    AC A0A0B7N6U1.1
#=GS A0A1Y2VW00_9PEZI/673-815    AC A0A1Y2VW00.1
#=GS G3XV77_ASPNA/301-373        AC G3XV77.1
#=GS Q0UZC8_PHANO/361-435        AC Q0UZC8.2
#=GS A0A1B8GNS0_9PEZI/548-704    AC A0A1B8GNS0.1
#=GS A0A0N0NRB6_9EURO/357-444    AC A0A0N0NRB6.1
#=GS A0A0D2E8L9_9EURO/644-800    AC A0A0D2E8L9.1
#=GS A0A074W448_9PEZI/552-709    AC A0A074W448.1
#=GS A0A4R8QR31_COLTR/503-609    AC A0A4R8QR31.1
#=GS A0A423VTZ9_9PEZI/757-827    AC A0A423VTZ9.1
#=GS A0A3A2ZU51_9EURO/303-366    AC A0A3A2ZU51.1
#=GS A0A6A6YH16_9PEZI/456-553    AC A0A6A6YH16.1
#=GS A0A080WGP9_TRIRC/489-608    AC A0A080WGP9.1
#=GS A0A5N6K0E4_9HELO/531-622    AC A0A5N6K0E4.1
#=GS A0A3M9Y3F9_9PEZI/626-787    AC A0A3M9Y3F9.1
#=GS A0A3D8SX48_9EURO/529-662    AC A0A3D8SX48.1
#=GS A0A397HWZ0_9EURO/272-335    AC A0A397HWZ0.1
#=GS A0A0D2AI73_9PEZI/125-211    AC A0A0D2AI73.1
#=GS A0A0P8X2H8_9CLOT/41-109     AC A0A0P8X2H8.1
#=GS R8BUE6_TOGMI/744-875        AC R8BUE6.1
#=GS H6C6Y6_EXODN/638-795        AC H6C6Y6.1
#=GS A0A4V5NFE3_9PEZI/525-683    AC A0A4V5NFE3.1
#=GS A0A2I1CLY0_ASPN1/380-480    AC A0A2I1CLY0.1
#=GS A0A0D2BWC7_9EURO/625-785    AC A0A0D2BWC7.1
#=GS A0A0D1YR49_9PEZI/537-688    AC A0A0D1YR49.1
#=GS A0A0D9NRE2_METAN/602-729    AC A0A0D9NRE2.1
#=GS A0A0C9MGZ4_9FUNG/532-599    AC A0A0C9MGZ4.1
#=GS A0A2B7XC33_9EURO/568-706    AC A0A2B7XC33.1
#=GS A0A229X8A5_9EURO/372-477    AC A0A229X8A5.1
#=GS A0A168JB54_MUCCL/617-665    AC A0A168JB54.1
#=GS B4R4D9_DROSI/104-194        AC B4R4D9.1
#=GS T0KDB4_COLGC/626-696        AC T0KDB4.1
#=GS A0A0G4LM95_9PEZI/553-711    AC A0A0G4LM95.1
#=GS A0A074YSE8_AURPU/317-395    AC A0A074YSE8.1
#=GS B2WNY2_PYRTR/600-753        AC B2WNY2.1
#=GS A0A3D8SX48_9EURO/383-496    AC A0A3D8SX48.1
#=GS A0A0F8UEJ4_9EURO/379-488    AC A0A0F8UEJ4.1
#=GS A0A484G583_COLOR/1-63       AC A0A484G583.1
#=GS A0A5N5XDY5_9EURO/400-506    AC A0A5N5XDY5.1
#=GS A0A420YNZ3_9PEZI/696-762    AC A0A420YNZ3.1
#=GS H0EK30_GLAL7/634-744        AC H0EK30.1
#=GS J4UHD6_BEAB2/446-519        AC J4UHD6.1
#=GS E3QDR6_COLGM/476-516        AC E3QDR6.1
#=GS A0A3M6ZE02_HORWE/635-814    AC A0A3M6ZE02.1
#=GS A0A4Q4WLE6_9PEZI/502-574    AC A0A4Q4WLE6.1
#=GS A0A5N6K0E4_9HELO/661-710    AC A0A5N6K0E4.1
#=GS Q0C9I2_ASPTN/595-690        AC Q0C9I2.1
#=GS Q2TZD9_ASPOR/561-699        AC Q2TZD9.1
#=GS A0A1V8UUF7_9PEZI/407-490    AC A0A1V8UUF7.1
#=GS A0A100ITS5_ASPNG/401-507    AC A0A100ITS5.1
#=GS A0A178ZW35_9EURO/365-450    AC A0A178ZW35.1
#=GS A0A080WIC1_TRIRC/550-670    AC A0A080WIC1.1
#=GS A0A068RLC2_9FUNG/147-258    AC A0A068RLC2.1
#=GS A0A0S6X889_9FUNG/363-432    AC A0A0S6X889.1
#=GS A0A0F4GXD0_9PEZI/399-461    AC A0A0F4GXD0.1
#=GS A0A5N6TGK4_9EURO/265-331    AC A0A5N6TGK4.1
#=GS A0A1Y2EBN1_9PEZI/591-662    AC A0A1Y2EBN1.1
#=GS F7W3Z0_SORMK/439-492        AC F7W3Z0.1
#=GS A0A167BNN4_CORFA/444-514    AC A0A167BNN4.1
#=GS A0A165A7V2_XYLHT/98-169     AC A0A165A7V2.1
#=GS A0A425BSJ7_9PEZI/306-354    AC A0A425BSJ7.1
#=GS G2QTJ0_THETT/500-538        AC G2QTJ0.1
#=GS C4JEK8_UNCRE/210-276        AC C4JEK8.1
#=GS A0A1L9X4X7_ASPA1/524-652    AC A0A1L9X4X7.1
#=GS A0A1J9R696_9EURO/540-581    AC A0A1J9R696.1
#=GS A0A072PTE1_9EURO/382-455    AC A0A072PTE1.1
#=GS A0A0C9MGZ4_9FUNG/321-378    AC A0A0C9MGZ4.1
#=GS A0A0D1WQS0_9EURO/654-804    AC A0A0D1WQS0.1
#=GS A0A1Y2A0R4_9PLEO/591-736    AC A0A1Y2A0R4.1
#=GS A0A218ZBI5_9HELO/610-761    AC A0A218ZBI5.1
#=GS A0A5J5EQA4_9PEZI/293-342    AC A0A5J5EQA4.1
#=GS A0A1C1CTM8_9EURO/366-468    AC A0A1C1CTM8.1
#=GS A0A5Q4BUL9_9PEZI/644-789    AC A0A5Q4BUL9.1
#=GS A0A0D2CID4_9EURO/379-467    AC A0A0D2CID4.1
#=GS A0A507QN43_MONPU/510-691    AC A0A507QN43.1
#=GS A0A2B7XC33_9EURO/419-540    AC A0A2B7XC33.1
#=GS A0A5M9JLR0_MONFR/716-766    AC A0A5M9JLR0.1
#=GS V5G1I1_BYSSN/557-696        AC V5G1I1.1
#=GS A0A066XKL1_COLSU/524-653    AC A0A066XKL1.1
#=GS E3RIR8_PYRTT/543-696        AC E3RIR8.1
#=GS A0A2D3UP02_9PEZI/340-415    AC A0A2D3UP02.1
#=GS A0A1V6T0F1_9EURO/543-688    AC A0A1V6T0F1.1
#=GS A0A364N2H0_9PLEO/341-403    AC A0A364N2H0.1
#=GS L8G585_PSED2/503-624        AC L8G585.1
#=GS A0A0G2EJI4_9EURO/487-587    AC A0A0G2EJI4.1
#=GS A0A1V6RB58_9EURO/690-760    AC A0A1V6RB58.1
#=GS A0A5Q4BUL9_9PEZI/510-642    AC A0A5Q4BUL9.1
#=GS A2QKM3_ASPNC/556-695        AC A2QKM3.1
#=GS A0A178ZW35_9EURO/625-786    AC A0A178ZW35.1
#=GS A0A5N7DNY0_9EURO/414-513    AC A0A5N7DNY0.1
#=GS A0A2V1D6T8_9PLEO/401-446    AC A0A2V1D6T8.1
#=GS L8G585_PSED2/408-485        AC L8G585.1
#=GS A0A401L9C1_ASPAW/557-696    AC A0A401L9C1.1
#=GS A0A0N0NRB6_9EURO/594-749    AC A0A0N0NRB6.1
#=GS A0A2D3UP02_9PEZI/408-486    AC A0A2D3UP02.1
#=GS F7W3Z0_SORMK/375-438        AC F7W3Z0.1
#=GS A0A167RTY9_9PEZI/522-665    AC A0A167RTY9.1
#=GS A0A0F4YIE0_TALEM/339-441    AC A0A0F4YIE0.1
#=GS M7SU52_EUTLA/431-503        AC M7SU52.1
#=GS A0A3M7MC89_9PLEO/599-756    AC A0A3M7MC89.1
#=GS A0A5J5EQA4_9PEZI/457-519    AC A0A5J5EQA4.1
#=GS C0NM90_AJECG/562-700        AC C0NM90.1
#=GS C6HTC0_AJECH/382-462        AC C6HTC0.1
#=GS A0A0D1YR49_9PEZI/419-472    AC A0A0D1YR49.1
#=GS A0A1V1TG51_9FUNG/508-578    AC A0A1V1TG51.1
#=GS A0A2V1D6T8_9PLEO/553-691    AC A0A2V1D6T8.1
#=GS A0A5J5EQA4_9PEZI/240-296    AC A0A5J5EQA4.1
#=GS C0NM90_AJECG/407-521        AC C0NM90.1
#=GS F9XE98_ZYMTI/303-350        AC F9XE98.1
#=GS A0A0J8RJW6_COCIT/510-554    AC A0A0J8RJW6.1
#=GS S3DTS4_GLAL2/689-740        AC S3DTS4.1
#=GS A0A3N4L4M6_9PEZI/313-363    AC A0A3N4L4M6.1
#=GS F7W3Z0_SORMK/486-613        AC F7W3Z0.1
#=GS A0A101ME85_9EURO/545-585    AC A0A101ME85.1
#=GS A0A317X6X5_9EURO/401-507    AC A0A317X6X5.1
#=GS W9CAG8_SCLBF/706-866        AC W9CAG8.1
#=GS A0A1Y2VW00_9PEZI/623-681    AC A0A1Y2VW00.1
#=GS A0A168JB54_MUCCL/266-308    AC A0A168JB54.1
#=GS A0A2I1CLY0_ASPN1/526-643    AC A0A2I1CLY0.1
#=GS A0A7D8YMR6_9HELO/650-802    AC A0A7D8YMR6.1
#=GS A0A010Q3X1_9PEZI/647-698    AC A0A010Q3X1.1
#=GS A0A0D2I679_9EURO/381-460    AC A0A0D2I679.1
#=GS A0A063BU25_USTVR/416-462    AC A0A063BU25.1
#=GS A0A3M9Y3F9_9PEZI/511-601    AC A0A3M9Y3F9.1
#=GS A0A1C1CLL1_9EURO/496-603    AC A0A1C1CLL1.1
#=GS A0A4Z0YIZ2_9PEZI/606-661    AC A0A4Z0YIZ2.1
#=GS W9WD84_9EURO/642-822        AC W9WD84.1
#=GS A0A1L9X4X7_ASPA1/372-469    AC A0A1L9X4X7.1
#=GS C1HCJ5_PARBA/521-660        AC C1HCJ5.2
#=GS A0A1L9RA18_ASPWE/478-646    AC A0A1L9RA18.1
#=GS A0A5N6Z5V7_9EURO/268-343    AC A0A5N6Z5V7.1
#=GS A0A5N6UXE2_9EURO/415-515    AC A0A5N6UXE2.1
#=GS A0A423W6A9_9PEZI/591-734    AC A0A423W6A9.1
#=GS A0A2J6T2U0_9HELO/470-560    AC A0A2J6T2U0.1
#=GS K9FWG0_PEND2/544-691        AC K9FWG0.1
#=GS A0A5N7BNB9_9EURO/565-608    AC A0A5N7BNB9.1
#=GS A0A2C5YVS7_9HYPO/279-338    AC A0A2C5YVS7.1
#=GS V5G1I1_BYSSN/410-507        AC V5G1I1.1
#=GS A0A423W6A9_9PEZI/771-839    AC A0A423W6A9.1
#=GS A0A2N3N5F7_9PEZI/644-721    AC A0A2N3N5F7.1
#=GS A0A177CV39_9PLEO/1-101      AC A0A177CV39.1
#=GS A0A3N4M4W7_9PEZI/469-578    AC A0A3N4M4W7.1
#=GS A0A4U0TPH1_9PEZI/392-480    AC A0A4U0TPH1.1
#=GS A0A139ISU8_9PEZI/658-831    AC A0A139ISU8.1
#=GS A0A4U0TPH1_9PEZI/632-799    AC A0A4U0TPH1.1
#=GS A0A1L9PHY0_ASPVE/333-462    AC A0A1L9PHY0.1
#=GS A0A364N2H0_9PLEO/562-719    AC A0A364N2H0.1
#=GS E9E4W9_METAQ/602-663        AC E9E4W9.1
#=GS A0A135U1E0_9PEZI/692-844    AC A0A135U1E0.1
#=GS A0A165A7V2_XYLHT/359-408    AC A0A165A7V2.1
#=GS M3CFH9_SPHMS/555-643        AC M3CFH9.1
#=GS M2TBE1_COCSN/587-741        AC M2TBE1.1
#=GS W9WD84_9EURO/379-466        AC W9WD84.1
#=GS A0A1G4B989_9PEZI/642-700    AC A0A1G4B989.1
#=GS A0A395IIY0_9HELO/616-773    AC A0A395IIY0.1
#=GS A0A1V6UUK8_9EURO/544-690    AC A0A1V6UUK8.1
#=GS A0A2I2G2G6_9EURO/272-339    AC A0A2I2G2G6.1
#=GS A0A135U1E0_9PEZI/515-643    AC A0A135U1E0.1
#=GS A0A0J8RJW6_COCIT/287-350    AC A0A0J8RJW6.1
#=GS U7PSX9_SPOS1/723-832        AC U7PSX9.1
#=GS A0A319A1B2_9EURO/520-648    AC A0A319A1B2.1
#=GS A0A135M0D6_PENPA/537-678    AC A0A135M0D6.1
#=GS R8BUE6_TOGMI/546-644        AC R8BUE6.1
#=GS Q4X209_ASPFU/555-690        AC Q4X209.1
A0A4U6XQ92_9PEZI/644-699               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KK.KEKDE.D..............................RR.S..R..D..RA...........S.......R..........SRS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rdrsisrdr...................................................................................
A0A139HNL0_9PEZI/429-506               ..........................khrsrsrsKSLSR.........RQ.Q...L....GG....LA.A....V.A...G....V....A.A....L.A..G....Y...A..LN....KN.KNKET.Iivn.......................dghrRR.S..R..S..RR...........R.......R..........HSV.....--..........DT..Y.ISD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------eerehrdpgh..................................................................................
A0A3M7AWJ3_HORWE/348-405               ..............................nrvg-----.........-R.D...V....AG....AA.L....G.-...A....V....G.A....E.A..I....H...R..YR....SK.SRRRR.-..............................SR.S..R..S..RS...........G.......S..........FD-.....--..........RY..Y.DGP....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrrsrsqsl...................................................................................
A0A3M7AWJ3_HORWE/397-486               ................................rr--RSRsqsl.dlskAQ.K...L....GG....LA.A....V.A...G....V....A.A....L.A..G....Y...A..IK....KK.KKKNE.Tiivn......................egrpRR.S..R..S..RR...........R.......R..........ASV.....--..........DS..Y.MSP....S......E..E....G....S..........K.A..H.SPE...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hknrriaqag..................................................................................
A0A5N6ZL79_9EURO/304-377               .........................rsrsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........SS..V.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ksgrttdgekrses..............................................................................
A0A5N5K296_9PEZI/524-571               ..................................RKRSR.........SR.S...V....AK....AA.V...gT.A...A....V....A.G....L.V..Q....H...F..RN....KS.KARDG.K..............................SR.S..R..S..RL...........R.......T..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gae.........................................................................................
A0A0C9MGZ4_9FUNG/114-150               .............................hykrd-----.........--.-...-....--....-A.A....A.A...G....A....A.G....L.A..G....H...E..LK....DH.HDQSS.N..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lnnhsttgn...................................................................................
A0A0D2BWC7_9EURO/479-597               ..................................RSRSR.........IR.Q..aL....PV....VA.A....G.L...G....S....A.A....V.A..-....G...L..YE....KH.KAKKE.Aeeiad...................drrrarSR.S..R..S..RA...........R.......S..........EH-.....--..........AY..Y.DGP....G......Q..G....A....V..........N.D..P.GLI..eYG..N.AP.MYG.NN-........YG.........AD..Y.Y...G.R...P........P....PPDG................YYS.......NAV.VP....AA-....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tgpaagygaq..................................................................................
A0A2J6T2U0_9HELO/599-749               ..................................RSRSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YR....KR.KEKKE.A..............................ER.E..K..E..RR...........R.......Y..........EED.....ESp.......teHY..Y.DRD....Y......R..D....E....D..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PD..N.N...Q.F...P........P....PPTGqft.........qqpmNTQ.......LPV.HP....ADA....A..PIPP......YNP..AD...Y..A...GQ......PAPA....-...A...H..N..P.Y.P.Y..............PE................GTGDNVSA...ERSR.------prpps.......................................................................................
A0A319DWF9_9EURO/524-662               ..................................RHHSR.........SR.D...I....AE....AA.L....A.A...G....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................ER.D..K..D..RP...........E.......S..........DDD....aRR..........GP..Y.DGS....Y......N..N....P....P..........Y.A..P.SPA...AA..S.QQ.IDD.HQ-........YY.........PN..S.N...F.F...P........P....PSGA................APR.......---.--....---....P..EPAP......YSP..AD...Y..P...PP......PGAV....P...P...-..Q..P.Y.D.Y..............PA................RPGPNTYA...PQPR.RADENV............................................................................................
A0A2U1MVF2_ARTAN/17-87                 .....................lkefsagnpctcl-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...-M..G.QP.SLD.DYE........YY.........PK..S.N...Y.Y...A........K....PPNK................GRE.......--N.QH....RRS....F..ACLE......AVP..ADd.eY..I...Q-......----....-...-...-..-..-.-.-.-..............--................--------...----.------eqssaelsel..................................................................................
A0A1Y2LKH8_EPING/601-753               ..................................RSKSR.........AR.G...L....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..R..D..RR...........H.......E..........DESa...ySQ..........SS..Y.SPG....R......R..Y....S....P..........D.R..Y.SPG..qST..A.RP.EDS.R--........YF.........PE..S.N...Y.F...P........P....PPTA................---.......P-L.D-....-HN....A..PYPP......YNP..AD...Y..P...AP......NNYG...pP...P...P..A..P.G.G.Yih.........edmNPgn............pyARQDQTHY...HQTR.RGDENV............................................................................................
F9XE98_ZYMTI/636-827                   ..................................RNHSR.........SR.N...A....AI....GG.A....A.L...G....G....A.A....L.A..A....H...E..MG....KR.RERSK.VakenrrerecrqsaddedlltqipgrddhqED.Y..Y..D..DR...........R.......H..........DDR.....RH..........DD..R.DNN....-......-..-....M....G..........Y.N..D.YP-...QS..N.AP.YGG.QPS........TY.........PT..S.H...Y.F...P........P....PPTG................EDA.......ARN.DP....YGAq..pQ..TYPA......YNP..AD...Y..A...GQ......PAQQ...hP...P...Y..D..Q.G.Q.Ygg..........geIPygesa.....dpninqPYPGDAYA...GDQR.------ygaehe......................................................................................
A0A1Y1JK43_PLAGO/54-158                ........................istavlglai-----.........--.-...-....--....--.L....A.N...V....L....L.G....V.G..Y....H...S..YK....KK.QNEKQ.K..............................EQ.E..K..K..QQ...........Y.......Q..........RH-.....FQ..........QK..F.QKS....Y......-..E....K....P..........L.Q..Q.QPE..qQQ..K.QP.SEQ.QLK........Q-.........PS..E.Q...Q.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lkqqpkqnysdyklktdsnknsktvk..................................................................
F0U958_AJEC8/417-526                   ......................kspgrirqgipi-----.........--.-...-....AV....AG.L....-.-...G....S....A.A....-.I..A....N...L..YE....KH.KEKKE.S..............................ES.-..S..E..RK...........E.......K..........NHR.....RRsr.....srsMA..R.SST....Y......-..P....D....P..........S.R..S.SPQlieYG..D.DP.V--.---........-Yg......siPA..N.N...Y.Y...G........R....PPSR................QSS.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------spraieasprrss...............................................................................
A0A395GJ13_9EURO/302-374               .......................rsrsrsrsrsh-SHSR.........AR.T...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....N...K..SN....SN.KDRRS.-..............................-R.S..R..H..RR...........S.......S..........SHR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svrgtdeegrsqsq..............................................................................
A0A2N3N5F7_9PEZI/422-468               ..................................RKRSR.........SR.S...F....AK....AA.L....AtA...A....T....A.G....I.V..K....H...F..RN....KS.KSRSR.-..............................SR.S..R..S..KS...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tkgrs.......................................................................................
J3KI03_COCIM/349-390                   ................................dh----R.........NR.R...M....AE....AG.L...aG.A...A....V....A.G....L.V..E....H...V..RS....KS.RSRKG.R..............................SR.S..R..I..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tg..........................................................................................
A0A094DD18_9PEZI/423-500               ..................................RSKSR.........IR.T...G....AE....LA.A....A.G...L....A....S.A....A.A..A....G...L..YE....RR.KAKQE.G..............................DR.S..V..S..RS...........L.......S..........RSK.....SR..........SR..S.RGV....R......G..Y....D....E..........Y.E..R.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------pglveygaqplhsrg.............................................................................
A0A3N4L4M6_9PEZI/263-318               ..................................RDHRR.........AR.H...L....AE....AG.L....G.V...A....A....A.G....A.A..K....E...L..YD....HR.KRTHR.R..............................SS.S..A..S..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sissanantghethng............................................................................
W9Y839_9EURO/483-592                   ................................keRSRSR.........IR.Q..aL....PI....VA.A....G.L...G....S....A.A....L.A..G....-...L..YE....KN.KAKKE.Aee.........................iakEQ.R..R..A..RS...........R.......S..........RSR....aKS.........dGY..Y.DGP....R......-..D....A....A..........L.S..D.PGLi.eYG..T.GP.MYG.NN-........FG.........PD..Y.Y...G.R...P........P....PPEG................Y--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ygasdavvp...................................................................................
G2WRI8_VERDV/510-640                   ..............................rsrsRSKSR.........IR.Q...G....AE....VV.A....-.A...G....L....A.G....G.A..A....S...K..LW...hSR.KDKKE.Akere......................lsdeEY.E..E..E..QR...........R.......R..........---.....--..........DR..A.ARR....R......S..R....S....R..........S.Q..A.RS-...LY..S.EP.RTD.GPIgl....veY-.........-G..T.D...-.-...P........L....PPSQ................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ppyptndygyesassqrrrrrsrgrgaddyspsg..........................................................
B5YNX9_THAPS/110-231                   ..........................rnggedde-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..YE....ME.--RRR.-..............................QM.E..E..E..RY...........R.......L..........QDE....iRH..........QM..D.DDN....Y......S..D....H....H..........S.R..Q.LSR...RS..R.DP.ESD.EAS........RR.........SN..M.S...G.V...P........P....PPRS................VRS.......--G.HS....QSH....Q..SRSR......YDP..DG...M..S...HD......FGAD....D...P...-..D..G.R.H.Y..............AP................GLN-----...----.------nhggvpsvhtg.................................................................................
A0A4Q7JFY5_METCM/641-767               ..............................xxxx-----.........--.-...-....--....AG.A....A.A...G....A....A.A....M.G..I....K...E..FK....DR.KDRKD.Qdkrd......................rrsrER.D..E..D..RR...........R.......R..........DDD.....--..........--..R.RED....Y.....fD..D....H....V..........R.P..H.SP-...--..-.-P.TAS.GGA........YY.........PP..-.-...-.Y...P........P....TPGGppmas.....ganytpYPD.......QNG.GA....PLH....P..EYQP......YVP..QD...Y..M...GY.....aPPP-....-...-...-..-..-.-.-.-..............--................--------...----.------ppppag......................................................................................
A0A425BSJ7_9PEZI/463-511               ............................htgakt-----.........--.-...-....AG....AL.G....A.A...G....A....A.G....Y.G..A....H...E..YK....KH.HDNK-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyagndyatgsgagygndy.........................................................................
A0A167RTY9_9PEZI/750-901               ...............................rdh-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...D..RD....RH.RDEYR.-..............................DR.D..R..N..RR...........H.......H..........DGD.....-D..........GA..Y.DDY....Y......N..E....H....D..........G.H..G.PP-...--..S.PP.HAS.GGA........FY.........PP..-.-...-.-...-........-....PPQPtppit......gsgafMQH.......PNV.AT....TDL....R..QTDP.....lYAP..TDhhdY..P...PP......PGP-....P...P...S..T..G.A.P.Lh............sQPa..............vHAQEAPVN...PNP-.------agqhvhhadednpipdlnrpanndnd..................................................................
A0A139HNL0_9PEZI/635-793               ..................................RSRSR.........RR.N...L....AE....AG.A....A.A...G....V....A.A....V.A..A....H...E..IG....KR.RERSR.As............................rSR.S..R..E..RR...........R.......P..........ED-.....--..........DY..Y.EDR....R......A..D....D....P..........Y.S..P.PPM..gNS..Y.PP.YQN.QDPya....qqAY.........PG..A.N...Y.F...P........P....PPNG................ETS.......GYV.EP....QPA....Y..AHAQ......YNP..AD...Y..A...GQ......PATQ...aP...Y...D..H..Q.Q.A.Ygg..........ysEPy..............pGQSHHSYA...HDAQ.YGD---egr.........................................................................................
A0A3N4M4W7_9PEZI/216-267               ...............................hgh---HR.........GR.K...I....AA....AA.L....G.A...T....A....A.G....A.A..A....H...H..MY....KR.RQRSR.A..............................RS.S..D..S..YS...........S.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------spsdtdhht...................................................................................
A0A1W2TCT9_ROSNE/613-787               ................................kkRSRST.........LR.D...V....AA....AG.L....G.T...A....A....A.A....I.G..I....K...K..YS....DH.QKNKE.Rgersregseaqs.....rsrdrsdrardrrSR.D..R..Q..RR...........Rg.....gY..........EEE....aAG..........NS..Y.YPS....Y......D..V....N....A..........P.P..P.SP-...--..-.-P.NAS.GG-........-F.........PP..A.N...Q.G...P........P....PPPPvgp..........ggfTHH......sNQS.TT....NLN....N..PYPP......YNP..QD...Y..V...NIp....pPPPG....P...P...P..A..P.G.S.Y.............fPP................-P------...----.------gvpghgtgpen.................................................................................
A0A319DWF9_9EURO/269-339               .........................rsrsrsrsq-SHSR.........VR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....SK.SNSNK.E..............................RR.S..R..S..RH...........R.......H..........ASN.....SR..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrsvkgtdeersqs..............................................................................
A0A2V5HPZ2_ASPV1/302-363               ...........................rsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...AaiagA....V.A....L.A..R....N...K..SN....SN.KDRR-.-..............................SR.S..R..H..RR...........A.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asstrslplnk.................................................................................
A0A1B7P428_9EURO/525-661               ..................................RSKSR.........TR.D...F....AT....AG.L....A.A...A....G....A.G....I.A..A....R...E..YT....QR.QERKR.A..............................EK.D..R..R..KY...........A.......D..........DHD.....-Y..........HS..F.EGN....Y......E..P....A....P..........Y.V..P.SP-...--..-.-P.PSG.TN-........YY.........AQ..G.N...H.F...P........P....PPGS................TPV.......P--.--....-PN....T..APGP......YNP..AD...Y..P...PP......PGAP...pQ...A...Q..S..S.Y.P.Y..............PP................PPEMDPYA...PRSG.RGDENV............................................................................................
A0A3N4M4W7_9PEZI/263-316               .............................tdhht-----.........GR.K...V....AG....AA.L....G.A...T....A....A.S....I.A..A....H...K..IH....QH.RRKSK.S..............................SS.G..R..S..RS...........S.......S..........SG-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rehphhrk....................................................................................
A0A2B7ZQA7_9EURO/312-382               ...........................rhrsrss-SDSR.........VK.T...L....AS....LG.L....G.A...A....A....I.AgavaL.A..R....K...Q..SQ....KN.AEKSN.N.............................nS-.-..R..S..RR...........S.......R..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srhrrgsesssgegqtss..........................................................................
A0A4U6XQ92_9PEZI/512-643               ................................rsRSKSR.........LR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKD.R..............................EL.D..R..ElsDQ...........E.......Y..........EEE....lRR..........ER..R.ERR....R......S..R....S....R..........S.Q..A.-RS...LY..P.EP.RRA.DSElg....lvEYg......tsPL..P.T...D.P...P........Y....PPDG................GYE.......SAA.NE....RQR....R..RHRR......MSG..DD...Y..D...NA......----....-...-...-..-..-.-.-.-..............--................--------...----.------epakk.......................................................................................
S2JHI7_MUCC1/121-203                   ..............................hhkr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDQQS.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gldnhhassnplqpglghnshegvkssplhseaglgnhytsasnplrptsndhhy.....................................
A0A1W2TCT9_ROSNE/395-458               ................................rhRSKSR.........SR.L...A....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YMq..nNK.IDKEE.D..............................HR.G..R..A..RR...........R.......H..........SDD.....--..........-G..Y.SA-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsssrrg....................................................................................
A0A0D2BFS9_9EURO/644-799               ..............................rrqs-RRRS.........SR.D...A....TK....MA.A....A.A...G....A....G.A....V.A..A....S...E..YD....RR.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........EEGg...yGH..........DP..Y.EDS....Y.....nP..N....Q....Q..........Y.P..P.TPP..pPV..N.DP.YAS.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQ.......QQY.PP....QTS....N..PGAT.....tGNPygQA...Y..P...PP.....pPGPP....P...N...A..T..G.T.N.Y..............EA...............yASGANPYA...PRG-.------penv........................................................................................
A0A3M7AWJ3_HORWE/635-803               ..................................RSRSR.........AK.D...L....AG....AG.A....A.A...G....V....A.G....V.A..A....H...E..YG....KR.KERSR.Nre..........................aeSR.R..R..E..DE...........R.......Y..........EDR.....YRg.......dgDH..Y.EPP....Y......D..H....P....G..........Y.L..-.PP-...QA..Q.AP.YDN.HQ-........AY.........PG..G.N...Y.F...P........P....PPTD................DHVy.....dQAA.PP....QQP....N..PYPT......YNP..AD...Y..A...QG.....gPQHQ....P...Y...P..H..S.Y.G.A.............yDSeanl........gapyPGGNDTFA...GDTR.------yaptpehdgrr.................................................................................
A0A5N6KUS3_9ROSI/545-701               ..................................RHRSS.........RG.H...G....AE....EG.A....A.A...G....G...mA.G....I.A..A....H...E..AS....KR.RERKR.A..............................ER.E..R..R..RE...........-.......-..........EED.....RN..........DT..P.QQG....Y......G..F....G....P..........Y.AqeP.PPP...AA..M.PP.SAA.D-Yn.....nqYY.........PQ..P.P...N.F...A........P....PPNA................YSP......vP--.--....-NF....T..GQAP......YNP..QE...F..A...QPqp.qyaPQAV...pG...G...A..Q..P.Y.G.Ypa..........apAP................AEGNDARY...QQ--.------qghqvshe....................................................................................
A0A3A2ZU51_9EURO/552-686               ..................................KHRSR.........SR.D...L....AG....AA.L....A.G...T....G....L.G....Y.A..A....H...K..YS....KR.KDRKK.G..............................E-.-..-..-..-S...........K.......Y..........DDE....sHH..........DP..Y.EEP....Y......N..P....E....P..........Y.A..P.SPP...PV..S.QP.MDN.P--........YY.........PN..N.N...Y.F...P........P....PPGV................PP-.......---.--....QPA....G..NPAP......YNP..AD...Y..P...PP......PGAV....P...P...S..Q..N.Y.G.Y..............PP................-PGSEPYA...PRPR.RADENV............................................................................................
A0A4Q4UHQ5_9PEZI/560-730               ..................................RSRSK.........LR.N...V....AA....GV.L....G.T...G....A....A.A....I.G..I....K...K..YQ....DH.QKSLK.T..............................ET.E..L..E..VG...........G.......L..........ETV....sAD..........VG..Y.EDE....E......E..P....D....L..........Y.Y..S.DYDr.gAA..S.SP.HYA.SGG........YP.........PP..P.A...T.A...P........T....PPSP................GPA.......GPG.DF....TQH....S..NQST......MNL..NA...Y..P...PP......PPPKn..yN...P...R..Q..Y.T.A.Y..............RP...............pS-------...----.------pgppppgaghplgpenvshhvhfddassisrska..........................................................
G3XV77_ASPNA/556-686                   ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.D..R..D..RP...........-.......-..........--G.....KP..........CS..Y.KNP....L......-..-....-....P..........Y.P..A.TPA...AA..P.RP.IDD.HQ-........YY.........PN..G.N...Y.F...P........P....PPAT................GPR.......P--.--....---....-..EPAP......YSP..AD...Y..P...HP......PGPV....P...P...-..Q..S.Y.D.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
A0A0S6X889_9FUNG/574-741               .........................rrrsrsrsn-SRSR.........TR.G...L....AE....AA.A....A.A...G....I....A.G....A.A..A....H...E..LT....KR.SERKK.A..............................EK.E..R..R..REympcgpvlgahK.......T..........NDP....qGR..........ER..E.DEL....Y.....aQ..E....H....P..........Y.T..P.PPM..gAN..A.GE.YAH.QGD........YY.........PQ..S.N...S.F...P........P....PPAN................DYS.......ARE.AN....YPP....G..EYPP......YNP..AD...Y..P...PP......PGGG....P...N...A..G..V.D.H.Y..............PP................SPGAHYN-...----.------naggygpne...................................................................................
W9Y839_9EURO/107-205                   ......................paaerelvirrt-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..-T....ER.DDPRR.-..............................-D.E..V..S..VA...........R.......Y..........EDR.....GRd........vRI..A.ETR....Y......R..D....D....Y..........E.I..V.APS...RS..F.DD.RDL.QR-........YS.........RT..A.E...Y.F...T........P....PPQP................TTI.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------virqepiiirervrdddyqi........................................................................
A0A0D1Z4Z7_9EURO/625-782               ................................dr-SRRR........hSR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....T...E..YE....KR.KQERR.E..............................RR.A..R..K..RR...........E.......E..........EGY.....GR..........DP..Y.EDN....Y......H..PggqfA....P..........T.P..P.PPA...PV..N.DP.YAT.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQq....ypPQA.GP...aTAP....T..GAAP......YPP..QN...Y..P...PPp....pPPGA....P...P...A..P..A.Q.P.Y..............EA...............yASGANPYA...PRG-.------penv........................................................................................
A0A0D1Y3N1_9EURO/654-803               .................................h-SRRR.........SR.D...A....GR....SA.A....A.A...A....G....G.A....A.A..A....S...E..YE....SR.RKQEK.R..............................DR.K..A..R..KR...........R.......E..........EQG....yGA..........DP..Y.EDN....Y.....nP..A....Q....Q..........Y.S..P.TPP...PA..N.DP.YAT.QQG........FY.........PQ..S.S...Q.F...P........P....PPGA................VPQ.......QYP.QN....AAP....G..AANP......YPT..QS...Y..P...PPp....pPPGP....P...P...T..G..A.A.N.Y..............DP...............yASGANPYA...PRG-.------penv........................................................................................
A0A4U0TPH1_9PEZI/506-604               ................................rsRSKSR.........VR.Q...G....AP....IA.A...aG.L...G....G....A.A....L.A..G....-...L..YE....KN.KGNKE.Akka........................aavE-.-..-..E..EL...........R.......R..........GRR.....RR..........SR..S.RSR....S......I..P....A....P..........Y.P..A.SER..gID..E.RP.MIA.YGHe......pVY.........PE..Q.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------argyysdde...................................................................................
A1CSM6_ASPCL/393-490                   ..................................RSHSR.........LR.H...A....LP....VV.A....A.G...L....G....T.A....V.A..T....G...L..YE....KH.KMKEG.E.............................eGK.H..R..E..RR...........R.......A..........RSR.....SRa.......psEI..Y.PDP....N......R..D....SagliE..........Y.G..D.HPV...AG..S.IP.SA-.--H........YY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpasqqgyyhsda..............................................................................
A0A1X7RXD3_ZYMTR/303-349               ..............................rsrsRSQSR.........KR.S...L....AT....GA.L....-.-...A....G....A.G....A.A..A....I...L..GQ....HR.KKQGH.E..............................ES.H..R..G..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nvlg........................................................................................
A0A1L9STT0_9EURO/554-701               ..................................RHRSR.........SR.G...V....AE....AA.L....A.A...A....G....V.G....Y.A..A....H...K..YK....EH.RANKK.A..............................EH.D..R..K..GY...........D.......G..........EESd...rQR..........DP..Y.EEP....Y......N..P....E....P..........Y.L..P.SPH..pGA..S.GP.ASG.D-P........YS.........PN..G.S...Y.F...P........P....PPGA................-PV.......-IY.GP....ENT....H..YPPP......--P..AP...A..P...VP......PGAG...pH...P...P..Q..S.Y.N.Y.............pPP................PTGEQPYS...PMPR.RADENV............................................................................................
R0K5Y5_SETT2/571-717                   ..................................RSKSR.........VR.T...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AT....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........EDS.....--..........TY..S.TGT....Y......-..-....S....P..........Y.D..S.PS-...-P..S.TA.HAE.DSR........YF.........PE..T.N...Y.F...P........P....PPNA................S--.......--A.DP....NIH....N..PYPP......YNP..AD...Y..P...PG......PNHS...sQ...-...-..-..-.-.-.YvnvprdeshignpyVP................PQHQDHYY...GPPR.RMDGNV............................................................................................
A0A443HVL7_BYSSP/307-382               ...........................rsrsrss-SHSR.........AK.T...L....AE....LG.LgaaaL.A...G....V....V.A....L.A..R....N...K..SK....SR.DGRER.R..............................SR.S..R..H..RR...........G.......S..........SPS.....-D..........GG..S.EDD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------trddarnpahrn................................................................................
A0A6J3LYF8_9PEZI/595-765               ................................rhRSRSR.........SRaR...L....AQ....AA.G....A.A...G....L....A.G....I.A..A....H...E..IG....KR.RERSR.A..............................DK.Q..R..K..HE...........D.......-..........DDR....yND..........DR..Y.SDRg..pY......S..P....Q....P..........A.G..H.NQY..sAN..R.DQ.QQQ.QQQ........DY.........PG..G.H...Y.F...P........P....PPTD...............dY-S.......-NS.RE....VPAggsgN..GFAP......YNP..AD...Y..A...NR......SIDQ....P...I...Y..G..S.G.A.Y.............gEStg...........nlnTPRQE---...----.------nnfgaghsnntqaprderrgv.......................................................................
A0A179F7R8_METCM/607-741               ..................................RSKSR.........LR.D...M....AA....AG.A....A.A...G....A....A.A....M.G..I....K...E..FK....DR.KDRKD.Qdkrd......................rrsrER.D..E..D..RR...........R.......R..........DDD.....--..........--..R.RED....Y.....fD..D....H....V..........R.P..H.SP-...--..-.-P.TAS.GGA........YY.........PP..-.-...-.Y...P........P....TPGGppmas.....ganytpYPD.......QNG.GA....PLH....P..EYQP......YVP..QD...Y..M...GY.....aPPP-....-...-...-..-..-.-.-.-..............--................--------...----.------ppppagp.....................................................................................
A0A0J8RJW6_COCIT/347-391               ..............................dpdh----R.........NR.R...M....AE....AG.L...aG.A...A....V....A.G....L.V..E....H...V..RS....KS.RSRKG.R..............................SR.S..R..I..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tgi.........................................................................................
A0A0K8LFQ8_9EURO/377-478               .................................sRSHSR.........LR.Q...A....--....LP.V....V.A...A....G....L.G....T.A..A....V...TglYE....KN.KEKKE.E..............................EG.K..R..R..ER...........R.......R..........SRS.....RS..........RA..P.SEA....Y......-..P....D....P..........A.R..D.SAGlieYG..E.HP.VTG.S--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ipaahyygrpasqqgyysdasdrv....................................................................
F2SD33_TRIRC/551-673                   .................................nRSRSRhgn...gnlAA.G...L....AA....AS.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......Y..........DRD.....YR..........DP..Y.EEE....Y......-..P....S....P..........P.G..P.PPG..pAS..Y.QP.PAA.QE-........YYgvpp.ppgpPG..G.R...G.Y...P........P....PPGP................PP-.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gpgyfggpgpggppvyrgd.........................................................................
A0A3N4M4W7_9PEZI/309-354               ..........................rehphhrk-----.........--.-...-....AK....LA.A....A.A...I....G....T.G....L.A..A....R...H..LH....HR.REARF.K..............................PS.S..R..S..RS...........R.......E..........R--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ep..........................................................................................
A0A168JGH6_CORDF/451-561               ................................rsRSKSR.........LR.T...G....AK....IA.G....A.A...A....A....A.G....V.A..G....K...L..YK....NH.QEKKE.R..............................SR.S..R..A..RS...........D.......T..........DDD.....--..........RY..Y.GRR....D......R..S....R....S..........R.S..R.SMA...RS..L.HS.DAG.ADRelg..lveY-.........-G..N.G...E.L...P........P....PPDR................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rgydsdddrrsrrrrs............................................................................
A0A1L9TGA8_9EURO/465-599               ..................................KHRNR.........SR.D...L....AG....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RDRQR.E..............................--.-..D..Q..DG...........R.......Y..........DSD....vPP..........SP..Y.DEP....Y......S..P....G....P..........Y.P..P.SP-...--..-.AP.NAS.FD-........GR.........PN..-.N...Y.Y...P........P....PPGP................GPA.......PM-.--....--G....P..SAAP......YNP..AD...Y..P...PP......PNAA....P...P...P..Q..Q.Y.N.Y..............PP................PPGPDAYA...PRPR.RADENV............................................................................................
A0A7H8QYA3_9EURO/261-326               .........................rhrsrsrss-SHSR.........AK.T...L....AG....IG.L....G.A...A....A....L.A....G.A..V....A...V..AR....KK.SQSNK.G..............................RR.S..R..S..RH...........R.......R..........DSP.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srgddarapsk.................................................................................
J3KI03_COCIM/510-672                   ..................................RERSR.........SR.D...L....AT....AG.L...aA.A...G....A....A.G....L.A..A....H...K..YA....QR.KERKK.N..............................ER.D..R..R..RD...........E.......E..........E-A.....RQ..........DS..Y.DDT....Y......S..T....I....P..........Y.P..P.SPP...PP..S.AS.SYP.QDN........YY.........PQ..T.N...Q.FaqsPnq...ttgP....PPGH................YQY......pPSN.YP....PPG....T..ASMPppnhvsHNP..AD...Y..P...PP......PGAP....P...P...A..Q..H.Y.N.Y..............PV................PPAQDPYA...HLQP.RGDENV............................................................................................
A0A2B7ZQA7_9EURO/416-529               .........................kspsrikqg-----.........--.-...L....PI....AA.A....S.L...G....S....A.A....I.-..A....N...L..YE....KH.KEKKE.S..............................ES.S..E..R..QD...........K.......R..........HRR.....RS..........SR..S.RSV....R......R..S....A....T..........Y.S..D.PSR...SA..P.QL.IEY.GDD.......pVYg......siPA..N.N...Y.Y...G........R....PPSR................QSS.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------spraieasprrssrka............................................................................
A0A2G7FKH8_9EURO/354-453               .................................sRSHSR.........LR.K...A....LP....VI.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKQE.Eg...........................eaSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.R--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------iptadyygrptsqqayysdasd......................................................................
A0A1V6Z231_PENNA/547-692               ..................................KHHSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YK....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......H..........DDV.....HR..........DP..Y.EES....Y......D..P....E....P..........Y.P..P.SPQ..rAP..G.AP.PMA.DPH........YY.........PN..S.N...Y.F...P........P....PPGD................STY.......---.-N....LGG....G..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........avPP...............gGPGPDQYA...PRPR.RAEDNV............................................................................................
A0A4T0VLI6_9PEZI/496-624               ..................................RSKSR.........IR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKD.R..............................EV.D..R..ElsDQ...........E.......Y..........EEE....lRR..........ER..R.ERR....R......S..R....S....R..........S.Q..A.R-S...LY..P.EP.RSA.DPElg...lveYGt.......sPL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------msgddyddaepak...............................................................................
A0A1B8CI28_9PEZI/416-495               ..................................RSKSR.........IR.T...G....AE....LA.A....A.G...L....A....T.A....A.A..A....G...L..YE....RR.KAKQE.Gergvs....................rslsrSK.S..R..S..RS...........R.......G..........---.....GR..........RG..Y.DDD....F......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------erpglveygaqplhsrg...........................................................................
E3QDR6_COLGM/512-642                   ................................rsRSKSR.........LR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKE.R..............................EL.D..R..E..LSd.........dE.......Y..........EEE....aRR..........ER..R.EHR....R......-..S....R....S..........R.S..Q.ARS...LH..P.EP.HSA.DSElg...lveYGt.......sPL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....GRR....R..RHRR......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------msaddyddrepak...............................................................................
A0A3D8Q8W0_9HELO/620-790               ..........................rhrsrsrsRSQSR.........VR.D...I....AG....AA.L....G.T...G....A....A.A....I.G..I....H...Q..YK....KR.KEKKE.Adrererer..............errrevpqQ-.-..H..S..RS...........R.......Y..........EEE....aEP.........dNY..Y.AQN....Y......R..D....D....G..........Y.S..P.SP-...--..-.-P.HAS.GGA........YY.........TEhvN.T...S.F...A........P....PPTTqt...........tnfTQH.......TTT.TH....VND....G..PIPP......YNP..AD...Y..A...GQ......PAA-....-...-...-..D..S.Y.G.F..............PP................HPNDHVS-...----.------sappmngysqnq................................................................................
A0A423W6A9_9PEZI/831-974               .........................ekkerarek-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....AE.RDKAR.R..............................DR.E..R..D..RR...........R.......Y..........EES....iAD..........DL..Y.NAN....-......-..D....T....Q..........R.P..P.SP-...--..-.-P.HAS.GG-........FYng.....pvPP..A.V...P.D...P........I....PPVSdty.........hqgfTQHp.....nMAT.TN....LHD....A..PYPP......YNP..QE...Y..AefpPP......PPGP....P...P...N..S..A.-.A.Tpt..........gmPP................-PPTGGYR...PN--.------dpehtertlnv.................................................................................
A0A150VE66_9PEZI/539-622               ...........................rsksrgrRSKSR.........VK.Q..gV....PI....AA.A....G.L...G....G....A.A....L.A..Gl..yE...N..SK....AN.KERKQ.Qqi.........................iedER.N..R..G..RR...........R.......R..........SRT.....--..........--..-.---....-......-..-....-....-..........Y.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gnepiypetgrgyysdeepgm.......................................................................
A0A150VE66_9PEZI/640-781               ................................rrRSRSR........tGR.H...L....AE....AG.A....A.A...G....V....A.A....V.A..A....H...E..IG....KR.RERSR.-..............................QR.E..A..E..RR...........R.......H..........EDD.....--..........AG..Y.GDQ....Y......A..H....D....-..........H.G..D.---...--..-.-G.YNQ.QQ-........AY.........PS..S.N...Y.F...P........P....PPTG................EYA.......QQQ.PY....PEQ....N..PYPP......YNP..SD...Y..A...QQ......PASQ....Q...P...Y..-..P.E.T.Y..............VP................-YADESGA...PAPH.------antphaggary.................................................................................
A0A317V8F6_9EURO/299-368               ...........................rsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....NK.SNSNK.E..............................RR.S..R..S..RH...........R.......H..........ASS.....SR..........R-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsvkgtdeerrsqs..............................................................................
A0A1V1TG51_9FUNG/407-474               ............................rsrsrsRSKSR.........SR.L...A....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YMq..nSK.IEKEE.S..............................HR.G..R..R..RR...........R.......Y..........SND.....--..........-E..Y.SLS....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rspsrrg.....................................................................................
W3XH82_PESFW/344-396                   ................................dh--RSR.........--.D...-....AA....LA.F....G.A...G....A....A.A....Y.G..T....H...E..HE....QH.NKRSE.T..............................SA.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqpigsgtdpthadprtav.........................................................................
A0A2C5YVS7_9HYPO/28-92                 .................................d-HHSR.........LR.K...G....LG....LA.A....V.A...L....A....A.A....G.A..A....K...Y..YQ...sSK.IDKEE.A..............................HR.G..R..S..RT...........R.......G..........GYY.....SH..........DE..Y.SRS....V......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srvsrsps....................................................................................
A0A553HVQ4_9PEZI/601-658               ..................................RSKSK.........LR.D...V....AA....AG.L....G.T...A....A....A.A....I.G..I....K...K..YS...dHQ.KNKER.D..............................ER.S..R..E..RS...........V.......D..........PSR.....SR..........DR..S.DR-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------prd.........................................................................................
A0A177D9J9_ALTAL/595-748               ..................................RSKSR.........AR.T...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........DDS.....--..........AY..S.TGT....Y......-..-....S....P..........Y.D..S.PTP...ST..A.HP.NDS.R--........FF.........PE..S.N...Y.F...P........P....PPTA................---.......-PV.DH....NPN....N..PYPP......YNP..AD...Y..P...PP......PSAY....E...P...N..H..P.S.Q.Fv............nPPhedlhlg..npyapqhQQQHEPYY...GQPR.RGGDNV............................................................................................
A0A0A1TGS9_9HYPO/569-721               ..................................RSRSR.........LR.N...M....AA....AG.A....A.A...G....A....A.A....M.G..I....K...E..YK....NR.KDRKK.Rde.........................drhSR.E..R..S..QE...........R.......Y..........EDE.....--..........RR..H.ERR....Y.....dE..H....D....E..........R.P..Q.S--...--..-.PP.TAS.GGA........YY.........PP..-.-...-.Y...P........P....TPGA................-PY......gSPS.AA....QSY....D..NQQY......YVP..QDm.gY..A...PP......PPPGpppaP...N...T..G..P.A.N.Yg............pPP................PPGP----...----.------ppgpppgsnqapehg.............................................................................
A0A370TQE2_9HELO/611-770               ..................................RSRSR.........AR.E...I....VG....AA.A....G.T...A....A....A.A....I.G..I....D...K..YK....KR.KQKKE.Aer..........................erER.E..K..E..RR...........R.......Y..........EEE....aRP.........dNY..Y.ARD....F.....hD..D....D....Y..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...Q.F...P........P....PPADp.............gfTNH......pNFS.TP....NVA....Q..PPIP.....qYNP..AD...Y..A...GQ......PAPV....P...P...H..D..G.F.G.Y..............PPgpaa........pdglE-------...----.------hppgpaapragdnv..............................................................................
G7XHH0_ASPKW/403-503                   ..................................RRESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPG..lIE..Y.G-.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dhpvhgsippnyygrpvsphgyysda..................................................................
A0A1J9SBG8_9PEZI/348-427               ..................................RSHSR.........GR.K...V....AG....VA.A....L.A...A....V....G.A....L.A..Y....A...A..GR....GQ.KGNPS.Anv..........................ieRR.S..R..S..RR...........-.......R..........RHS.....VS..........GA..S.GDE....F......S..P....S....P..........S.R..S.RSK..sKS..R.DP.EHK.N--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------r...........................................................................................
A0A4Z1J7M5_9HELO/663-820               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YR....KR.KEKKE.Kkekk.....................daekhER.E..R..E..RR...........R.......Y..........EDE.....AP..........ES..Y.YTN....F......R..D....E....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...A.F...P........P....PPPSnpet........fthhGNKs.....tPFV.NE....IP-....-..PIPP......YNP..QD...Y..A...SQ.....rPTT-....-...-...H..D..S.H.H.Y..............PPs.............prVPG-----...----.------dnvsthqssnpe................................................................................
A0A0C9MGZ4_9FUNG/419-467               ..............................hykr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKQ-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sgidgtsplhsksgldnhhsat......................................................................
A0A0D2K9Q9_9EURO/364-452               ...............................rhr-SRSRsss...pskFK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKSN.Dd............................gDR.G..R..S..RS...........R.......S..........RSR.....RR..........RE..S.VSS....L......E..D....D....P..........D.A..P.SD-...DA..R.NP.KHR.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rntmak......................................................................................
A0A2N3N5F7_9PEZI/469-588               ..................................RSRSR.........LR.T...G....AE....LA.A....A.A...A....A....A.G....A.A..G....K...L..YK....RH.KEKKE.-..............................ER.A..R..S..RS...........L.......S..........RDS....sYY..........EP..R.DRS....R......S..R....-....S..........R.S..R.STT...RS..L.HP.EPS.PADrel..glvEY.........GH..D.P...L.P...P........E....PPYP................ED-.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------esdraarrrrrrrkrsgtagds......................................................................
A0A167BNN4_CORFA/568-705               ................................rkRSQSR.........LR.N...M....AA....A-.-....-.-...G....A....A.A....F.G..I....K...E..YK....DK.KDREK.R..............................ER.K..N..R..ER...........-.......-..........QHS.....-R..........DG..Y.DDG....Y......D..R....R....D..........-.R..H.VDR...PS..S.PP.HAS.GGA........YY.........PP..Y.P...T.T...P........G....PGGP................ADFh....pyDSP.GA....AQS....H..EFQP......YIP..QDymgY..A...PP......PPPG....P...P...P..A..P.-.-.-..............--................--------...----.------ipgpmtgyppepp...............................................................................
A0A425BTC8_9PEZI/434-507               ................................rsRSKSR.........VR.T...G....AE....IA.As..gL.A...G....A....A.V....A.G..L....Y...E..AR....KE.KEQRK.K..............................EAaE..Q..E..RL...........D.......R..........EE-.....ER..........RS..R.SRG....Y......D..P....S....P..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sydrrsrsrs..................................................................................
A0A2S7NRS5_9HELO/649-810               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...Q..YN....KR.RKEKK.Daek........................ekrER.E..Q..E..RR...........R.......Y..........EDE.....ASsp.....ppeNF..-.---....Yr....nP..N....S....T..........Y.R..D.EGF...TP..S.PP.HAS.GGS........Y-.........HS..D.N...H.F...P........P....PPTNstsvp.....pgfthhGNQs.....sPYI.NE....IP-....-..PIPP......YNP..QD...Y..A...GQ.....rPTH-....-...-...D..P..L.S.G.Y..............PP................PRTGDNVS...P---.------asipsp......................................................................................
A0A0F0I0U5_ASPPU/414-516               ..................................RSHSR.........LR.K...A....LP....VI.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKQE.Eg...........................eaSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PT..A.D...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grptsqqayysdasdpavs.........................................................................
M2TBE1_COCSN/345-430                   ..................................RSKSR.........AR.E...L....GT....LA.A....L.A...G....V....G.A....L.A..Y....A...A..GQ....RN.KAKTK.Eetv.......................tiieDR.H..R..S..RS...........R.......H..........RSK.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srhrrgrrksrsvsvvsdrsrsrstskhmdpe............................................................
H1UXZ2_COLHI/467-515                   ...........................rsrsrks-RKSR.........SR.S...V....AK....AA.A....A.T...A....A....A.A....G.L..V....Q...H..FR....NK.SNSKS.R..............................SR.S..R..S..KS...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------r...........................................................................................
A0A0C9MGZ4_9FUNG/487-519               .............................hhykr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDN--.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qigidn......................................................................................
A0A4U0XQT9_9PEZI/586-733               ..................katkeakkaaiiedel-----.........--.-...-....--....--.-....-.-...-....G....R.A....V.A..A....H...E..IG....KR.RERSR.Q..............................RE.E..V..Q..NR...........R.......H..........DPE.....PY..........QY..G.NEP....Y......P..L....D....S..........P.T..P.QPG...GY..L.PP.HQH.GAYgn....dpAY.........PS..S.T...Y.F...P........P....PPTG................---.......DFA.RG....EPE....V..APYP.....qYNP..AD...Y..A...QQ......---Q....P...Y...H..Q..S.Y.G.-..............--................--------...----.------tygdsdatwahrnrttplpatld.....................................................................
A0A2B7XJD2_9EURO/305-375               ...........................rhrsrss-SDSR.........VK.T...L....AG....LG.LgaaaI.A...G....A....V.A....L.A..R....K...K..SQ....KN.ADKSK.H..............................SS.H..D..R..RS...........R.......S..........RHR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rgsgsssnedkash..............................................................................
A0A0G3A5Q5_9ACTN/4-80                  ................................ll-----.........-R.G...I....AR....TA.V....V.A...G....T....A.T....A.V..S....N...H..VS....RR.QAGRW.A..............................QQ.D..Y..E..RQ...........Q.......Q..........YEQ.....--..........QY..A.QPE....Y......A..Q....P....Q..........Q.P..P.PPP...PA..A.PP.PAA.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------pddmtqkid...................................................................................
A0A2T3AHR6_9PEZI/859-1050              ..................................RSRSR.........LR.D...L....AT....GA.V....A.A...G....A....A.A....I.G..V....N...K..YN...eHK.KEEKR.Aksrereasker.......sisrdareerraE-.-..R..E..RA...........R.......K..........ERD....kAR..........NH..Y.EES....I......A..S....D....P..........H.D..DyGHQ..qPP..S.PP.TMS.GGA........YYgpp...qtpPA..V.R...Q.E...P........P....PANAsyg..........qgfTQH......pNVV.ST....DLN....D..GYRA......YNP..QD...F..V...PR......PPPG....P...P...P..N..T.A.T.Tpt..........gmPP................PP------...----.------tgghrplnpdhvsresss..........................................................................
A0A0F4GXD0_9PEZI/617-791               ..................................RNHSR.........SR.N...A....AI....GG.A....A.L...G....G....A.A....L.A..A....H...E..MG....KR.RERSK.V..............................AK.E..N..R..RE...........R.......R..........DDH.....QD..........DY..Y.DDR....R......H..D....D....RhhddrdnnmgY.N..D.YP-...QP..N.AP.YGG.QPS........TY.........PT..S.H...Y.F...P........P....PPTG................EDA.......ARN.DP....YGA....HpqTYPA......YNP..AD...Y..A...GQ......PAQQ...hP...P...Y..D..Q.A.Q.Ygg..........geISygesa.....dpninqPYPGDAYA...GDQR.Y-----gaehe.......................................................................................
G0SEH0_CHATD/485-525                   ..................................RSKSR.........AS.S...L....AK....AA.V....-.A...T....A....A.A....T.G..L....L...Q..HY....RH.KSKSR.D..............................GK.S..R..S..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------s...........................................................................................
A0A1J9Q7U5_9EURO/310-379               ...........................rhrsrss-SDSR.........AK.T...L....AGlglgAA.A....I.A...G....V....V.A....L.A..R....K...K..SQ....KN.AEKSN.S..............................SR.D..R..R..SR...........S.......R..........HRR....gSR..........SS..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sndaassh....................................................................................
C5G976_AJEDR/340-451                   ..........................rikqglpi-----.........--.-...-....AA....AG.L....-.-...G....T....A.A....I.-..A....N...L..YE....KH.KEKKE.S..............................ESsE..R..G..HR...........R.......R..........SRS.....KS..........VA..R.SST....Y......-..P....D....A..........S.R..S.APQlveYG..D.DP.IYG.S--........-I.........PA..D.N...Y.Y...R........R....PPSR................QPS.......--R.NR....RA-....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrtryrddgpgsgts...........................................................................
A0A3M7AWJ3_HORWE/500-606               .........................rsrsrggraRSKSR.........IR.Q...G....AP....IA.A...aG.L...G....G....A.A....L.A..Gl..yE...K..NK....AN.QESKK.Aai.........................iedEK.G..R..G..RR...........R.......R..........SRS.....RS..........RS..V.PAP....Yp....aS..E....R....S..........V.D..D.TPMi.aYG..H.DP.IYP.ESAr......gYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sdeep.......................................................................................
A0A0D2BFS9_9EURO/495-603               .................................eRSQSR.........VR.Q..aL....PV....VA.A....G.L...G....S....A.A....L.A..G....-...L..YE....KN.KAKKE.Aeli.......................akdgRR.A..R..S..RS...........R.......S..........RAR.....SD..........AY..Y.DGP....R......E..G....A....V..........S.D..P.GLI..eYG..N.GP.MYG.NN-........FG.........PD..Y.Y...G.R...P........P....PPEG................Y--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ygtsnavvp...................................................................................
A0A1Q5UC54_9EURO/541-684               ..................................KHRSR.........SR.E...L....AS....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YS....QH.RDRKK.T..............................ER.SrsR..S..RT...........R.......Y..........EDD....aHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..I.SAQ...AA..H.QR.PAE.N--........YF.........PN..S.N...Y.F...P........P....PPGS................TSN.......---.--....-LN....A..TPQP......YNP..AD...Y..P...PP......PGAA....P...P...A..Q..P.Y.N.Y.............gAA................NTGPETYA...PRPR.RADENV............................................................................................
G2XR77_BOTF4/694-852                   ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YR....KR.KEKKE.Kkekk.....................daekhER.E..R..E..RR...........R.......Y..........EDE.....AP..........ES..Y.YTN....F......R..D....E....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...A.F...P........P....PPTSnpet........ftnhGNKs.....tPFV.NE....IP-....-..PIPP......YNP..QD...Y..A...SQ.....rPTTH....D...P...-..-..-.H.H.Y..............PPs.............srVPGD----...----.------nvsthqssnpep................................................................................
A0A179UYF2_BLAGS/468-605               ..................................RSRSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKK.A..............................EK.E..R..R..TY...........P.......H..........DHD.....YL..........QS..F.EEE....Y......E..P....S....T..........Y.V..A.SP-...--..-.-P.LNS.P--........YY.........PQ..E.N...R.F...P........L....PPGS................TPI.......PP-.-P....PPN....V..QPGP......YNP..AD...Y..P...PP......PAAA....Q...P...P..P..N.H.P.Y..............PP................PPGGDSSA...PRT-.RADEN-k...........................................................................................
A0A165A7V2_XYLHT/202-299               ................................rsRSRSR.........LRkG...L....PI....AA.A....G.L...G....G....A.A....V.A..G....L...-..-Y....ER.NQKEK.E..............................EA.E..D..S..RR...........R.......H..........DHR.....RG..........SR..S.RSR....S......A..S....A....P..........Y.S..E.AG-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrgtasdpglieygdqpvytadyygvptgrr............................................................
A0A317X6X5_9EURO/302-365               ...........................rsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....AiagaV.A....L.A..R....S...K..SN....SN.KDRR-.-..............................SR.S..R..H..RR...........A.......S..........S--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srrsvrgtdee.................................................................................
W9XB18_9EURO/369-456                   ...............................rhr-SRSRsss...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKSN.Ddg..........................drGR.S..R..S..RS...........R.......S..........RSR.....RR..........RE..S.VSS....L......E..D....D....P..........N.A..P.SD-...DA..R.NP.KHR.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnt.........................................................................................
A0A425BSJ7_9PEZI/264-312               ...........................nnnhtga-----.........--.K...A....AA....GA.A....A.A...G....T....A.G....Y.A..A....H...E..HN....KK.HNNKD.T..............................TK.D..N..T..TG...........H.......H..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hnagk.......................................................................................
A0A163HMV4_DIDRA/361-431               ..................................RSKSR.........VK.E...V....VT....LA.A....L.A...-....G....V.G....L.A..A....Y...A..VG....KH.SKEKN.Apvtt.....................tvvkeHR.S..R..S..RR...........R.......R..........GTS.....RR..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gesrsrsvtvveed..............................................................................
A0A139HNL0_9PEZI/536-622               ................................rdRSKSR.........LR.T..gV....PI....AA.A....G.L...G....G....A.A....L.A..G....-...L..YE....KN.KANKE.A..............................KR.D..A..-..-V...........I.......E..........DEL.....GR..........GR..H.TSR....S......R..S....R....T..........Y.G..H.DP-...--..I.YP.ESH.RGQ........Y-.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sdeepghyrrrg................................................................................
A0A168JB54_MUCCL/784-843               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKES.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------glegahhtsgnplhpgsdninrsadgnndhhykr..........................................................
A0A1S9DDZ8_ASPOZ/304-375               .........................rsrsrshsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....R-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sssvrsgkttdgekrs............................................................................
A0A2T3BE08_AMORE/385-459               ..................................RSRSK.........SR.H..pV....MK....TA.Lg.laV.A...G....I....A.A....A.A..A....V...K..YA....QN.RKADR.E..............................EM.S..R..G..RS...........R.......T..........RSI.....SR..........RR..G.SGS....Y......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssdsdravsksrqss.............................................................................
A0A5N6FP34_PETAA/274-340               .........................rsrsrsrsh-SHSR.........VK.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHR.....RS..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssvrsgrsag..................................................................................
A0A0D1ZLV8_EXOME/661-832               ................................kh-RRKK.........SR.D...A....AK....LA.A....A.A...P....T....A.P....A.G..A....S...A..YD....RR.KEEKR.E..............................RR.A..R..R..QR...........E.......E..........EATa...yGH..........DA..Y.DDS....Y......H..Q....S....G..........-.R..H.SPT..pPP..N.DP.YAS.QHGfs...qptYY.........PE..N.T...Q.F...P........P....PPGSvpnqy.....psqpdpTPIq.....pGAA.EH....PPQ....A..AYVPq....aYPP..QA...Y..P...PP......PPGG....P...P...P..A..P.T.N.Y..............DA...............yASGANPYA...PRG-.------penvsae.....................................................................................
A0A0D2APJ8_9EURO/651-803               ...............................hhs-RRRS.........SR.D...A....AK....MA.A....A.A...G....A....G.A....V.A..A....S...E..YD....RR.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........DSY.....GH..........DP..Y.EDN....Y.....nP..A....Q....Q..........Y.P..P.TPP..pPA..N.DP.YAS.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQ.......QQY.PP....QTS....T..PGPT.....aGNP..YGq.aY..P...PP......PPGP....P...P...N..V..AvP.T.Y..............ET...............yASGANPYA...PRG-.------penv........................................................................................
A0A1X7RXD3_ZYMTR/399-478               ................................rsRSRSRsf.....nrTQ.K...L....GG....LA.A....V.A...A....V....A.A....L.G..A....Y...A..LK....NR.NNKET.Vivk.......................eqppRR.S..R..S..RR...........R.......R..........SSY.....--..........DS..A.P--....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssvrpgsehrspdhrn............................................................................
A0A3N4M4W7_9PEZI/346-419               ..................................RSRSRer....epwGR.H...L....AA....AA.L....G.A...T....A....A.G....L.A..H....H...E..YN....HH.HQPER.-..............................PR.P..V..L..RR...........S.......Y..........SDGglkghRN..........HI..F.SRN....R......S..P....S....P..........H.K..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hsk.........................................................................................
A0A6G1FTE2_9PEZI/552-722               ..................................RKRSK.........SR.G...M....GK....AA.La.agA.A...G....A....A.G....F.A..A....H...E..AT....KR.RERKK.A..............................EK.E..R..D..RT...........Y.......S..........HGD....aNQ..........ELiiS.LGQ....R......D..D....D....T..........V.S..-.SG-...TF..S.PP.NEY.QEPpp....gpYY.........PH..S.N...E.F..aP........P....PPGTgapypqh..ipnaapqYPPp.....nPGF.GE....PAY....G..NQPP......YNP..AD...Y..G...PP......GVNL....P...P...Q..D..P.-.-.Y..............PA................-PQQPPYN...Q---.------apgyrgpenv..................................................................................
A0A2G7FKH8_9EURO/253-316               .................................h-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...sKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........S-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svrsgrttdgekrs..............................................................................
A0A1G4B989_9PEZI/685-819               ..................................RSRSR.........DR.S...V....TR....ER.T....Y.S...G....E....R.D....Y.S..R....E...R..ST....DD.RMRNR.-..............................ER.E..R..D..RR...........R.......Y..........EED....aRN..........DE..Y.YDN....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGS........F-.........--..-.-...-.Y...P........P....PPAAaa............gfTQH......pNIS.TA....NLR....D..QYPP......YPS..SDs.vY..P...PG......PPPM....G...P...S..P..P.-.-.-..............--................--------...----.------latggaggyppppppgg...........................................................................
A7EI77_SCLS1/520-622                   ..................................RSQSR.........VR.T...A....AE....IA.G...sG.L...A....G....A.A....V.-..A....G...L..YE....NR.KAKKE.A..............................EE.D..E..E..HV...........R.......R..........ERV.....RV..........RS..R.TRS....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------trsrsrarstgvysdpgvdpelgmvqygtepvhthqqpapydrtneh.............................................
C4JEK8_UNCRE/273-315                   ................................eh----R.........NK.R...M....AE....AG.L...aG.A...A....V....A.G....L.I..E....H...A..RS....KS.RSRKG.R..............................SR.S..R..I..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tgi.........................................................................................
A0A0U5FQN0_9EURO/371-476               ................................rsRSKSR.........LR.K...A....LP....VV.A....A.G...L....G....S.A....V.A..A....N...V..WD....KH.KDKEA.Eea..........................vhRK.D..R..R..RS...........R.......S..........---.....RG..........RP..Q.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..D.HP.VTG.S--........-I.........PA..A.N...Y.Y...G........R....PVSS................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qgyhtdasdpvar...............................................................................
A0A1E1K211_9HELO/497-589               ..................................RSKSR.........IR.T...G....AE....IA.G....-.A...G....L....A.G....A.A..V....AglyE..NR....KA.KEDTR.Eld.........................vedDR.S..R..D..RR...........R.......S..........RRR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrarsigvysdpgvdpelgmvqygtepvythqettty.....................................................
E5R2F7_ARTGP/550-689                   ...............................rsp-SRSRhgn...gnlAA.G...L....AA....AG.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......H..........DRD.....YR..........DP..Y.EDE....Y......-..P....S....P..........P.G..P.PPG..pSS..Y.QP.PAA.QE-........YYgvppphpgpPG..G.R...G.Y...P........P....PPGP................---.......---.--....---....-..---P......--P..GP..gY..F...AG......PGPG....P...G...-..-..-.-.-.G..............PP................VYRGDENV...PQPS.HQNQN-g...........................................................................................
A0A5N6ZL79_9EURO/563-702               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aHQ..........DS..Y.GEP....Y......S..P....E....P..........Y.H..H.TA-...--..L.PP.QSN.EHQ........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....-PA....G..STTP......YNP..VD...Y..P...PP......PGAV....P...P...S..Q..S.Y.G.Y..............PP................PPGPESFV...SRPR.RADENV............................................................................................
A0A2P7ZDN6_9PEZI/487-604               .................................k-SRSR.........SR.I...R....AG....VP.V....A.A...A....G....L.G....G.AaiA....N...L..YE....RN.KARKE.Akq.........................ggvAR.E..R..S..LS...........R.......S..........RSR.....--..........--..S.RSR....S......R..S....V....P..........Y.S..E.DPGlrrAS..S.DP.ALI.E--........-Y.........GG..D.P...I.Y...P........E....RPGE................YRR.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rhrgsssdsspdrrrrrsrsr.......................................................................
A0A2B7ZQA7_9EURO/566-703               ..................................RSRSR.........TR.E...F....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKK.A..............................EK.D..R..R..KY...........D.......H..........DHD.....YQ..........DS..F.EEG....Y......D..P....A....P..........Y.A..P.SP-...--..-.-P.PNS.SN-........YY.........TQ..G.N...Q.F...P........P....APGL................TPI.......P--.--....-PN....V..QPGP......YNP..AD...Y..P...PP......PGAP...pQ...A...Q..S..N.Y.P.Y..............PP................PTGMDPYG...PRSA.RGDES-v...........................................................................................
A0A1V6P3Z4_9EURO/545-695               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSKE.R..............................ER.E..H..S..KR...........D.......D..........HHV.....HR..........DP..Y.EEA....Y......D..P....E....P..........Y.P..L.SPQ..tAP..G.AP.PMA.DPH........YY.........PN..N.N...Y.F...P........P....PPGD................STY.......---.-N....LNS....G..TPMS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaPPgp............gpGPGPEQYA...PRPR.RADDNV............................................................................................
E9DDF0_COCPS/382-494                   ..................................RSRSR.........IR.TgipI....AA....AG.L....G.S...A....A....I.A....A.A..Y....E...K..NK....AK.KEDKKeK..............................ET.R..R..A..RS...........R.......S..........RSK.....--..........-S..R.ARS....S......S..E....S....Q..........V.G..V.PPHlieYG..D.DP.VYG.R--........-I.........PA..S.N...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------graespyhtprnhthsrsrrspstdsw.................................................................
A0A2J6QGU0_9HELO/640-788               ..................................RSRSR.........VR.D...I....AG....VA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.KEKKE.A..............................ER.E..R..E..RR...........R.......Y..........EEE.....ESp.......aeHY..Y.DHD....Y......R..D....E....D..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.H...A.F...Q........P....PPTGp..............fTHQp....mnTPI.PP....AEA....A..PIPP......YNP..AD...Y..G...GH......-QAA....N...P...-..D..P.Y.P.Y..............PP................GTGDNVSA...ARSR.------pppata......................................................................................
A0A2T2NGB3_CORCC/572-704               ..................................RSKSR.........AR.K...A....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..R..R..KQ...........-.......-..........EDS.....--..........AY..S.TGS....Y......-..-....-....-..........-.S..P.PP-...--..S.TA.LGS.DPR........YF.........PE..T.N...S.F...P........P....PPSQ................TTA.......---.--....DPY....S..PYPP......YNP..AD...F..P...LP......PNAA....P...P...-..H..G.Y.T.P..............PPv..............hYESGNPYA...PGHRgRPDDN-v...........................................................................................
A0A063BU25_USTVR/577-740               ...............................rrsRSRSR.........LR.G...M....AE....AG.A....-.-...-....-....A.A....I.G..I....K...E..FK....DR.HDTKH.Kerrer....................rsrsrSI.D..H..H..RR...........G.......H..........DEG.....--..........SR..I.GDS....R......R..D....Y....F..........D.D..A.VPR...PH..S.PP.TAS.GGA........YY.........PP..Y.S...P.T...P.......gG....PPMApad.........nyvpYPE.......SHG.SA....PLR....K..EYKP......YVP..QD...Y..T...GG......----....-...-...-..-..-.-.-.-..............--................--------...----.------lsawtgsawtspaarrpapdwwesstrsygvnt...........................................................
A0A4Q4Z1G4_9PEZI/605-772               ..................................RSRSK.........LR.D...V....AA....GV.L....G.T...G....A....A.A....I.G..I....K...K..YQ....DH.QKSLK.Tetele....................vgglgIA.S..A..D..VC...........Y.......E..........DEE.....EP..........DL..Y.YSD....Y......-..D....R....G..........A.P..S.S--...--..-.-P.HYA.SGG........YP.........PP..P.A...T.A...P........T....PPSP................GPA.......GPG.DF....TQH....S..NQST......MNL..NA...Y..P...PPp....pPNNY....N...P...R..Q..Y.T.A.Y..............RP................--------...----.------pspgppppgaghplgpenvshhvhfddassisr...........................................................
A0A5N6EDR8_9EURO/414-518               ..................................RSHSR.........LR.K...A....LP....VI.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKQE.Eg...........................eaSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PT..A.D...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grptsqqayysdasdpavsgt.......................................................................
A0A1E1K211_9HELO/637-791               ..................................RSRSR.........VR.N...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.KEKKE.M..............................DR.E..R..E..RR...........R.......Y..........EEGp..vpEE..........NY..Y.ARD....Y......-..Q....D....D..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PQ..N.N...A.F...P........P....PPQPqpgft.....lhtttsTTQ.......VHQ.EG....IPA....Y..NIPA......YNP..AE...H..V...NQ......PQI-....P...H...P..D..P.Y.G.Y..............PP................NIGHNVSV...D---.------drpsdqahf...................................................................................
J3KI03_COCIM/287-350                   .................................t-SRSR.........AR.T...L....AG....LG.L....G.A...A....A....I.A....G.A..V....A...L..AK....KH.SEKSS.K..............................QR.S..S..G..RR...........S.......R..........SHR.....RR..........SS..S.ASS....S......S..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dardpdh.....................................................................................
A0A5N5DQ18_9PEZI/348-427               ..................................RSHSR.........GR.K...V....AG....VA.A....L.A...A....V....G.A....L.A..Y....A...A..GR....GQ.KGNNV.Anv..........................veRR.S..R..S..RR...........-.......R..........RHS.....VS..........GA..S.GDE....F......S..P....S....P..........S.R..S.RSR..sKH..R.DP.EHK.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nr..........................................................................................
A0A139ISU8_9PEZI/431-506               ............................rsrsrsKSLSR.........RQ.Q...L....GS....LA.A....V.A...G....V....A.A....L.A..G....Y...A..LN....KN.KNKET.Iivn.......................dghrRR.S..R..S..RR...........R.......R..........HSV.....--..........DT..Y.VSD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------eerehrdpgh..................................................................................
A0A4Q7JFY5_METCM/464-566               ..................................RSKSR.........LR.R...V....AE....IG.G....V.A...A....A....A.G....V.A..N....K...L..WK....NH.KEKKE.Ntrdlsasg.............ddeyyrrrdSR.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srhrsvsggrhrsrsrsmarspyaqpgadpelglveygndplypesrda...........................................
A0A194X7G0_9HELO/634-780               ..................................RSHSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.KEKKE.A..............................ER.E..R..E..RR...........R.......Y..........EEE.....APp........eNY..Y.ARN....Y......P..D....D....G..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..T.N...Q.F...A........P....PPQApag..........fthHNN.......QST.PH....VNE....T..NIPP......YNP..AD...Y..A...GQ......---Q...pP...N...H..D..P.Y.G.Y..............PP................RTGDNVSN...DTTS.R-----qtp.........................................................................................
A0A2S7QP56_9HELO/514-606               ..................................RSQSR.........VR.T...G....AE....IA.A....-.S...G....L....A.G....A.A..V....A...G..LY....ER.RQAKK.Da...........................evED.E..R..E..RR...........R.......S..........RSR.....SR..........AR..S.TGV....Y......S..D....P....G..........V.D..P.ELGmvqYG..T.EP.VYT.HQQ........QA.........PY..D.R...D.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dpa.........................................................................................
A0A0S7DWY3_9EURO/377-477               .................................sRSHSR.........LR.Q...A....--....LP.V....V.A...A....G....L.G....T.A..A....V...TglYE....KN.KEKKE.E..............................DG.K..R..R..ER...........R.......R..........SRS.....RS..........RA..P.SEA....Y......-..P....D....P..........A.R..D.SAGlieYG..Q.HP.VTG.S--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ipaahyygrpasqqgyysdasdr.....................................................................
A0A150VE66_9PEZI/433-518               ..........................krrsrsrsKSLSR.........AQ.Q...L....GG....LA.A....V.A...A....V....G.A....L.A..G....Y...A..LN....KR.SNKET.Vivnn......................dgppRR.S..R..S..RR...........R.......G..........AS-.....VD..........TY..Y.TDE....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lshgggkalnpehrn.............................................................................
M7SU52_EUTLA/536-613                   ..................................RSHSR.........IR.T...G....AE....IA.A....-.A...G....L....T.G....A.A..A....S...K..LW....ER.HKNKK.-..............................EH.K..K..D..KE...........V.......D..........DD-.....--..........SY..Y.SDD....R......S..R....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srglvpvavpgveygsqpidlhdgy...................................................................
A0A6J3LYF8_9PEZI/380-457               ............................rrrsqs----RswaltpaekLG.G...L....AA....VA.A....V.A...G....L....A.G....Y.A..L....N...K..NK....KE.TV---.Viqen......................gpppRR.S..R..S..RK...........R.......R..........GSL.....--..........DS..Y.L--....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------keetkhadpeh.................................................................................
A0A1X7RXD3_ZYMTR/636-810               ..................................RNHSR.........SR.N...A....AI....GG.A....A.L...G....G....A.A....L.A..A....H...E..MG....KR.RERSK.V..............................AK.E..N..R..RE...........R.......R..........DDH.....QE..........DY..Y.DDR....R......H..D....D....RrhddrdnnmgY.N..D.YP-...QS..N.AP.YGG.QPS........TY.........PT..S.H...Y.F...P........P....PPTG................EDA.......ARN.DP....YGAq..pQ..TYPA......YNP..AD...Y..A...GQ......PAQQ...hP...P...Y..D..Q.G.Q.Ygg..........geIPygesa.....dpninqPYPGDAYA...GDQR.------ygaehe......................................................................................
A0A420YNZ3_9PEZI/551-686               ................................ksRSRSR.........LR.T...G....AE....IV.A....-.A...G....L....V.G....A.A..G....K...K..LY...dRH.KEKK-.-..............................EL.E..R..E..LE...........E.......E..........D--.....--..........-E..Y.YRE....M......E..D....R....D..........R.R..H.GGR...-S..R.SR.SA-.---........HS.........SR..S.A...A.R...P........P....YPEA................LPA.......---.--....DPE....L..GMVE......YGA..HP...L..Y...SD......PAAV....P...P...A..E..Y.D.R.Y.............gIP................RDGGERRH...GRRR.DRYD--dvsd........................................................................................
G3JMF7_CORMM/253-331                   .......................ekssnlkwlgp-----.........--.-...-....--....--.-....L.A...A....G....A.G....LwA..L....L...R..NG....KK.KQNRE.R..............................SR.S..R..S..RS...........R.......S..........PSS.....YRtnpe..vlssRG..Y.SER....F......Y..D....D....K..........Y.S..E.PPQ..rKS..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sggg........................................................................................
S3CWZ7_OPHP1/455-495                   ................................rp-KKSR.........SR.S...V....AK....VA.A...gT.A...A....V....A.G....I.V..H....H...F..RS....KS.RQRDG.K..............................A-.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsh.........................................................................................
A0A423W6A9_9PEZI/477-555               .......rsrsrprddrdddgerdrhskiktglg-----.........--.-...L....AA....AA.L....-.-...A....V....A.G....-.A..A....K...Y..YQ...sQK.AEKEE.L..............................HR.G..R..S..RH...........R.......N..........DDD.....SD.........gSY..Y.SHS....R......T..P....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sgk.........................................................................................
A0A1V6QJC9_9EURO/545-694               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......R..........DDN....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..tAP..G.AP.PMA.DPH........YY.........PN..N.N...Y.F...P........P....PPGD................STY.......---.-N....LNS....G..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaPPgp............gpGPAPEQYA...PRPR.RADDNV............................................................................................
A0A4Z1HB19_9HELO/637-791               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YR....KR.KEKKE.Kkekk.....................daekhER.E..R..E..RR...........R.......Y..........EDE.....AP..........ES..Y.YTN....F......R..D....E....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...A.F...P........P....PPPSnpet........fthhGNKs.....tPFV.NE....IP-....-..PIPP......YNP..QD...Y..A...SQ.....rPTTH....D...P...-..-..-.H.H.Y..............PPs..............sR-------...----.------ipgdnvsthqss................................................................................
A0A0J8QS49_COCIT/28-142                ..................................RSRSR.........IR.TgipI....AA....AG.L....G.S...A....A....I.A....A.A..Y....E...K..NK...aKN.EDKKE.K..............................ET.R..R..A..RS...........R.......S..........RSKs...rAR..........SS..S.---....-......-..E....S....Q..........V.G..V.PPHlieYG..D.DP.VYG.R--........-I.........PA..S.N...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------graespyhtprkhthsrsrrspstdswss...............................................................
A0A0D2DIH2_9EURO/472-589               .......................rsksrardgkeRSRSR.........IR.Q..aL....PV....VA.A....G.L...G....S....A.A....V.A..-....G...L..YE....KH.KAKKE.Aee.........................ivdER.R..R..A..RS...........R.......S..........RSRa..rsEH..........AY..Y.DGP....A......Q..A....A....M..........T.D..P.GLI..eYG..N.AP.MYG.NN-........FG.........PD..Y.Y...G.R...P........P....PAD-................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyysnavvp...................................................................................
A0A161Y9K7_9PEZI/696-763               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KK.KEKEM.D..............................ED.R..R..S..RE...........R.......N..........ARS....rSR..........D-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsisrdraysrdraysr...........................................................................
W9WD84_9EURO/496-601                   ..................................RSRSR.........IR.Q..aL....PV....IA.A....G.L...G....S....A.A....V.A..G....-...V..YE....KH.KAKKE.Aeeivd...................knrrarSR.S..R..S..RA...........R.......S..........EHS.....--..........AY..Y.DGP....P......P..P....Q....N..........D.Q..S.LVE...YG..N.TP.MYG.NNFg.....adYY.........--..-.-...-.G...R........P....PPQE................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyyssavv....................................................................................
A0A1J9R696_9EURO/411-518               ............................grirrg-----.........--.-...L....PI....AA.A....G.L...G....T....A.A....V.-..A....N...L..YE....KH.KEKKE.S.............................eSS.E..R..G..HR...........R.......R..........SRS.....RS..........MA..R.SST....Y......-..P....D....A..........S.R..S.APHlveYG..D.DP.IYG.S--........-I.........PA..D.N...Y.Y...G........R....PPSQ................QSS.......--R.H-....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrasrsrtryhddgs.............................................................................
A0A101ME91_9EURO/1-78                  ................................ma-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.DPH........YY.........PN..N.N...Y.F...P........P....PPGD................STY.......---.-N....LNS....G..TPMS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaPPgp............gpGPGPEQYA...PRPR.RADDNV............................................................................................
A0A074YPM7_AURSE/306-384               ..................................RSRSR.........AR.T...L....AK....VG.T....V.A...A....V....G.A....L.A..A....Y...A..LR....NR.GNKET.Vivnn.....................evpppRR.S..R..S..RR...........R.......R..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asvgsvpppldardrsrseskhrdpe..................................................................
A0A1J9Q7U5_9EURO/563-703               ..................................RSKSR.........TR.D...F....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKR.A..............................EK.D..R..R..KY...........A.......D..........DDD.....YQ..........DS..F.DDS....Y......D..P....A....P..........Y.A..P.SP-...--..-.-P.PND.LN-........YY.........GQ..G.N...Q.F...P........P....PPGT................TPV.......P--.--....-PN....V..PPGP......YNP..GD...Y..P...PP......PGAP....P...P...Q..A..Q.P.S.Ypy..........ppPP................PPGMDPYA...PRSS.RADENV............................................................................................
A0A2C5YVS7_9HYPO/143-204               ..................................RSKSK.........LR.R...G....AE....IA.G....A.A...A....A....A.G....V.A..G....K...L..WK....NH.QDKKE.-..............................AR.E..R..S..AS...........R.......D..........DDR.....--..........DH..Y.RRS....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gravsrsrs...................................................................................
A0A0D2FDQ0_9EURO/497-604               ..................................RSRSR.........IR.Q..aL....PV....IA.A....G.L...G....S....A.A....V.A..G....-...V..YE....KH.KAKKE.Aeeive...................knrrarSR.S..R..S..RA...........R.......S..........EH-.....-S..........AY..Y.DGP....P......A..P....P....T..........N.E..Q.SLV..eYG..N.TP.MYG.NN-........-Y.........GA..D.Y...Y.G...R........P....PPQD................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyysnavvp...................................................................................
A0A0F8UEJ4_9EURO/530-673               ..................................RHRSR.........SH.D...L....AG....AA.L....A.A...T....G....V.G....Y.A..A....H...R..YS....QH.KDRQA.A..............................EN.E..R..E..RQ...........R.......F..........KDE....gRP..........AP..Y.DEP....Y......N..S....E....P..........Y.P..P.SP-...AP..G.QP.VDS.SQ-........Y-.........KP..G.N...Y.Y...P........P....PPGS................APA.......---.--....LVA....S..GPAP......YIP..AD...Y..A...PPp...nvPAPA....P...P...Q..Q..Q.-.-.Yy............pPP................PAGPNTYA...PQSR.AVDEN-s...........................................................................................
S3CWZ7_OPHP1/661-722                   ..................................RSQSR.........LR.N...L....AA....GG.A....A.A...A....A....A.A....I.G..I....K...K..YE....DK.KKRDD.S..............................KR.R..E..E..ER...........S.......R..........DDG.....--..........SV..Y.NDD....Y......D..H....E....R..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hqsh........................................................................................
A0A178E8Z5_9PLEO/580-633               ..................................RSKSR.........AR.T...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........STN.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rpprkts.....................................................................................
A0A0C9MGZ4_9FUNG/278-317               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.QNQQ-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------fgfanhragnnpiqs.............................................................................
M1W061_CLAP2/575-717                   ................................rkRSKSR.........LR.D...M....AA....AG.A....-.-...-....-....A.A....I.G..I....K...D..FK....DR.HDRKG.Kd...........................rrDS.R..S..S..RS...........R.......D..........DDD.....RRh.......heGA..S.RRD....Y......-..-....-....F..........D.D..A.GPR...PH..S.PP.TAS.GGA........YY.........PP..-.-...-.Y...P........P....TPGDhpma.......sganyTPYp....ggQGG.RS....MSG....A..EFQP......YVP..QD...Y..T...GYa...ppPPP-....P...P...-..-..-.-.-.-..............--................--------...----.------agpppmpse...................................................................................
A0A0D1XL11_9PEZI/537-689               ..................................RSRSR.........SK.G...L....AE....VA.A....A.A...G....V....A.G....V.A..A....H...E..LT....KR.RERRR.-..............................--.E..R..E..RR...........R.......Q..........EEE....aAA..........AA..S.NSE....Y......T..S....T....T..........D.A..N.SP-...--..-.--.---.---........YY.........PA..S.N...H.F...A........P....PPNAaeg.........gyppMNH.......PND.SA....YYS....N..PVPP......YNP..AD...Y..G...PT......TGPT...lP...R...D..D..P.Y.A.Q..............PYnqqh.......hdnfaTPHQDPYS...PKNK.------dprapenv....................................................................................
A0A2V5HPZ2_ASPV1/554-688               ..................................RHRSR.........SR.E...F....AE....AA.L....G.A...A....G....V.G....Y.A..A....H...K..LA....QR.NERKK.A..............................ER.D..R..D..RS...........V.......L..........TNH.....--..........EP..D.EAP....Y......Q..H....D....P..........Y.P..P.SP-...AA..L.RP.IDD.HQ-........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....---....T..EPAP......YNP..AD...Y..P...PP......PGAV....P...P...-..Q..P.Y.A.H..............PA................HPESDPYA...PRPR.RVEENV............................................................................................
A0A3N4M4W7_9PEZI/170-219               .................................g-HHGR.........VR.H...L....AQ....AG.L....A.S...G....A....L.G....P.A..-....K...E..IH....DH.RGRRR.V..............................ED.T..S..P..SD...........S.......S..........DE-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ghghh.......................................................................................
A0A5J5EQA4_9PEZI/524-604               ..................................RDHSR.........VG.Q...L....AA....VT.A....A.T...M....A....G.A....L.A..E....R...H..HL....RK.QERRA.Rsadggs..................phrrltNE.E..R..R..HQ...........K.......H..........RHH.....--..........HH..H.HHR....E......D..D....S....E..........S.S..P.PP-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrlsgi......................................................................................
G4N0D9_MAGO7/696-761                   ..................................RSKSR.........LR.E...M....AA....AG.A....G.A...A....A....A.A....I.G..L....K...G..IQ....KR.REKSK.E..............................RD.E..E..E..ER...........R.......H..........EDE.....MR..........ER..D.RDR....D......R..D....R....P..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnrsrv......................................................................................
G0SEH0_CHATD/522-587                   ..................................RSRSR.........LR.T...V....AE....MT.A....-.A...G....L....A.G....A.G..A....K...K..LY...dSH.KEKKE.A.............................kER.E..R..D..RD...........R.......G..........ESD.....YE..........SE..F.ERD....R......R..R....R....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------drshsh......................................................................................
A0A2N3N5F7_9PEZI/600-650               ..................................RSRSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....M.G..F....K...E..YK....DR.KKSKE.R..............................ER.D..L..A..SD...........R.......E..........ADS.....A-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------der.........................................................................................
A0A3N2Q3M1_9PEZI/703-833               ..............................svdt-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...D..YA....RD.RDRSR.R..............................RR.D..R..D..RR...........R.......Y..........EDE....aNQ..........NP..Y.YDD....Y......-..-....-....G..........H.P..P.SP-...--..-.-P.HAS.GGA........YY.........PP..-.-...-.-...P........P....PPSQggpg.......ypplnH-Nv.....nPDY.AS....MPG....H..DPYP.....sYHP..QD...Y..G...GY......PPPG...pP...P...T..A..S.G.G.Ag...........gfPP................--------...----.------ptpggppagpgpagpag...........................................................................
A0A0G2EJI4_9EURO/637-779               ................................khRSRSQ.........SH.D...L....AT....AG.V....A.A...A....G....G.A....L.A..A....N...E..YQ....KR.KERKR.Aek..........................eaRR.E..E..R..RR...........R.......E..........AEA....aHQ..........EP..Y.EEG....Y......D..P....A....P..........Y.V..P.---...--..-.-P.AQD.--Q........YY.........PQ..S.N...N.F...P........P....PPGA................VPQ.......E--.--....-YP....Q..QQNP......YNP..GD...Y..Q...AH......PGSI....P...Q...-..P..G.T.A.Y..............NPsy............paNPAV-DQY...GRPR.RGDENV............................................................................................
A0A1Q5Q9J0_9EURO/479-625               ..................................RSGSR.........IR.D...L....AE....AG.L....A.A...A....G....L.G....Y.A..A....S...K..VSnnmkDK.KDRDR.R..............................SR.E..R..E..SR...........R.......H..........DDD....rDT..........DS..Y.EEP....Y......D..P....A....P..........Y.T..P.TP-...PP..A.GP.VPA.SGN........YY.........PY..T.N...S.F...P........P....PPGT................SPN.......---.--....---....P..PPAS......YNQ..TD...Y..P...SA......SGAV...pP...P...A..H..-.-.G.Y..............PPpp............aaPPGNEPYA...PQPR.RVDD--iv..........................................................................................
Q0UZC8_PHANO/537-676                   ........rrlrrnaindvslptanietsctess-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......P..........GDE.....DS..........AY..S.TGS....Y......S..P....Y....D..........S.P..R.PST..tST..S.HP.NDS.R--........FF.........PE..S.N...Y.F...P........P....PPTA................---.......P-I.DH....Q--....A..PYPP......YNP..AD...Y..P...PP......PSTT...fE...P...S..H..P.S.T.Yv............hPPhddinh...gnpyappQHQSNYYY...GQPR.RPDDNV............................................................................................
A0A0B7N6U1_9FUNG/281-349               ............................dhhrtr-----.........--.-...-....-D....AA.L....G.A...S....T....N.G....V.A..G....S...E..MQ....KH.PNENK.N..............................TS.S..S..Q..VR...........A.......S..........NNS.....SP..........KS..S.TEK....K......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gaaahdkplntggdahh...........................................................................
A0A559LZI3_9HELO/493-635               ..................................RSRSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.REKKE.A..............................ER.E..K..E..RR...........R.......Y..........EEEs...pAE..........NY..Y.SRE....Y......-..-....D....D..........Y.S..P.SP-...--..-.-P.TAS.GGS........YF.........PQ..S.N...E.F...P........P....PPANp.............gyTQHs.....nQSS.PN....INQ....Q..PIPP......YNP..AD...Y..A...GP......PPA-....-...P...H..D..A.Y.G.H..............PP................QPRGDNVS...A---.------sqyynn......................................................................................
M1W061_CLAP2/430-517                   ..................................RSKSR.........LR.R...V....AE....IG.G....V.A...A....A....A.G....V.A..N....K...L..WK....SH.NDKKE.R..............................AR.S..R..S..VG...........G.......V..........DDD.....N-..........YP..R.HD-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrgryrslsrsrhrsrsrsivpspysqagadpe.........................................................
A0A3M6ZE02_HORWE/509-606               ..................................RSKSR.........IR.Q...G....AP....IA.A...aG.L...G....G....A.A....L.A..Gl..yE...K..NK....AN.QESKK.Aai.........................iedEK.G..R..G..RR...........R.......R..........SRS.....RS..........RS..V.PAP....Yp....aS..E....R....S..........V.D..E.PPMi.aYG..H.DP.IY-.---........--.........PE..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sargyysdeep.................................................................................
A0A094JE74_9PEZI/406-494               ..................................RSKSR.........IR.T...G....AE....LA.A....A.G...L....A....T.A....A.A..A....G...L..YE....RR.KAKQE.Gergvs....................rslsrSK.S..R..S..RS...........R.......G..........GRR....kLD..........DD..Y.ERP....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------glveygaqplhsrglergyadqr.....................................................................
A0A1L9PHY0_ASPVE/467-601               ..................................KHRNR.........SR.D...L....AG....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QH.RDRQR.E..............................DK.D..G..-..--...........R.......Y..........DSD....vPP..........SP..Y.EDP....Y......S..P....G....P..........Y.P..P.SP-...--..-.AP.NAS.FD-........GR.........PN..-.N...Y.Y...P........P....PPGP................GPA.......P--.--....-MG....P..GPAP......YNP..AD...Y..P...PP......PNAA....P...P...P..Q..Q.Y.N.Y..............PP................PPGPDAYA...PRPR.RADENV............................................................................................
A0A423VTZ9_9PEZI/565-711               ................................rsRSQSR.........LR.T...G....AE....IV.A....-.A...G....L....A.G....A.A..G....K...K..IY....DR.QKAKK.E..............................DR.E..K..E..LS...........D.......E..........EYD.....-R..........DM..R.ERE....R......E..R....S....R..........S.R..R.DR-...-S..V.--.SES.RSR........SR.........SR..S.R...S.R...P........P....PPST................SA-.......--A.AA....DPE....L..GLVE......YGG..HP..lY..S...EP......PLPE....D...-...-..D..R.R.G.Ygpa........aagPP................EPGYESAD...ERKR.RRR---erqq........................................................................................
A0A425BTC8_9PEZI/531-682               ..................................RSRSR.........VR.D...L....AG....AA.L....G.A...T....A....T.A....I.G..I....D...Q..YR....KR.KERKE.Re............................aEA.E..R..E..RR...........R.......Y..........EEE....pESp.......sdHY..Y.SQR....H......Y..D....D....D..........Y.P..P.SP-...--..-.-P.HAS.GGS........YY.........PE..S.N...Q.F...P........P....PPVDp.............gyPPQ.......AAS.PH....VPQ....P..PIPP......YNP..AD...Y..A...GQ......PTG-....-...-...H..H..D.S.Y.F..............PP................PNGADNPR...HS--.------pdnvpppptsq.................................................................................
A0A166MYR9_9PEZI/514-645               ................................rsRSKSR.........IR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKD.R..............................EL.D..R..E..LSd.........hE.......Y..........EEE....aRR..........ER..R.ERR....R......S..R....S....-..........R.S..Q.ARS...LY..S.EP.RSA.DPElg...lveYGt.......sPL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......MSG..DD...Y..D...DP.....eP---....-...-...-..-..-.-.-.-..............--................--------...----.------akk.........................................................................................
A0A4Q3S325_9CAUL/2-146                 ............................krlila-----.........--.-...L....TA....AA.C....V.A...G....P....M.A....M.A..A....T...D..AA...aQN.RDRWE.R..............................-R.D..D..R..RE...........R.......R..........DDR....wER..........RD..D.RRD....Y......R..R....D....R..........R.E..D.RRE...SR..W.DR.QRH.NGY........YY.........RN..R.W...H.Y...G........P....PPSA................YYN......dPYY.RP....GYA....A..WRRG.....aYLP..SY...Y..R...SN......----....-...-...-..-..-.-.-.-..............--................--------...----.------syrvydygryrlrapprgyywyrsgndy................................................................
A0A2I2FP96_9EURO/520-673               ..................................KHRSR.........SR.S...V....AE....AA.L....A.A...A....G....V.G....Y.G..A....H...K..YS....QR.KDRKK.T..............................ER.S..R..S..RP...........R.......Y..........DDD....gRY..........DT..H.DDP....Y......Y..S....E....P..........Y.S..PySPP..ySS..S.PP.VRS.A-Id.....shAY.........PN..G.S...P.F...P........P....PPGS................APR.......---.--....-PA....G..SAAP......YHP..GE..yY..P...PPpgaippPGAV....P...P...Q..P..A.Y.A.G..............PP................PSGREPYA...PRPR.RADEN-i...........................................................................................
A0A4S3JBJ6_9EURO/368-472               ..................................RARSR.........SH.S...T....LR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KH.KDKKE.Etk..........................deSR.Y..R..E..RR...........R.......S..........RSR.....SRa.......psDF..Y.PDP....A......-..-....-....-..........-.R..D.SA-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dlieygedpvhgsipaanyygrsmtpqgyysdas..........................................................
G3JMF7_CORMM/459-600                   ...............................ggg-----.........--.-...V....AK....GI.L....G.G...L....G....M.G....W.I..A....K...K..LA....DR.RNKKQ.E..............................ER.L..R..E..--...........-.......E..........DDM.....RS..........GT..N.VSR....F......T..G....D....G..........Y.P..S.PTR...DS..R.RP.PPV.RRQt......gY-.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gasygtdtalsemtessidhpprvgarsdniqpvpmplrpprssgppvsepvsmpsmpadphgvlhsgae......................
A0A4Q4Z1G4_9PEZI/387-447               ................................rsRSKSR.........SR.L...K....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YMq..dNK.SEKEE.A..............................TR.G..R..S..RR...........R.......Y..........STS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tssgsrsrg...................................................................................
A0A3F3Q8Y6_9EURO/403-500               ..................................RRESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPGlieYG..D.HP.VH-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gsiphnyygrpvsphgyy..........................................................................
M7SU52_EUTLA/643-785                   ..................................RSRSR.........LR.E...V....AA....GV.L....G.T...G....A....A.A....I.G..L....K...K..YQ....DR.QKSKD.R..............................DR.D..R..D..RD...........R.......K..........RDE.....-K..........PR..Y.EDE....A......Q..P....D....P..........Y.Y..S.DY-...DV..E.AP.PSP.--H........YA.........SG..G.A...Y.Y...P........P....PPGP................APPp.....aTMP.TP....PPT....G..PAGP.....gAAP..GD...F..V...QH......PNQS....-...T...M..N..L.N.A.Y..............PP................PPPLNTYN...PQD-.------ytni........................................................................................
H0EK30_GLAL7/414-499                   ................................rs--RSRsssr.hshtK-.-...-....VK....TA.Lg.laV.A...G....L....A.A....A.A..A....A...K..YV....SN.RNQNK.Ee............................lGR.G..R..S..RT...........R.......S..........RGR....gRS..........SS..Y.SSD....Y......G..S....R....A..........R.S..K.SV-...-H..T.DP.KH-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnat........................................................................................
A0A4V2RGI9_9ACTN/4-75                  ................................ll-----.........-R.G...I....AR....TA.A....V.A...G....T....A.T....V.V..A....G...R..VQ....RH.QASKF.A..............................QR.D..A..E..TA...........A.......Q..........RD-.....--..........QA..Y.DEQ....V......A..P....Q....E..........S.A..A.PPQ...DA..A.PP.PA-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------paadpl......................................................................................
A0A177D9J9_ALTAL/354-428               ..................................RSKSR.........VK.E...L....GT....LA.A....L.A...G....V....G.A....L.A..Y....A...A..GQ....-R.NKNKT.Avkeet....................vtvieDR.H..R..S..RS...........R.......H..........GGR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrksrrrhrsvsavgsd.........................................................................
A0A0G4PFU6_PENCA/547-696               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......R..........DDH....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..tAP..G.AP.PMA.DPH........YY.........PN..N.N...Y.F...P........P....PPGD................STY.......---.-N....LNS....G..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaPPgp............gpGPAPEQYA...PRPR.RADDNV............................................................................................
A0A2S7NRS5_9HELO/514-606               ..................................RSQSR.........VR.T...G....AE....IA.A....-.S...G....L....A.G....A.A..V....A...G..LY....ER.RQAKK.Da...........................evED.E..R..E..RR...........R.......S..........RSR.....SR..........AR..S.TGV....Y......S..D....P....G..........V.D..P.ELGmvqYG..T.EP.VYT.HQQ........QA.........PY..D.R...D.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dpa.........................................................................................
A0A0J8RJW6_COCIT/382-491               ..................................RSRSR.........IR.TgipI....AA....AG.L....G.S...A....A....I.A....A.A..Y....E...K..NK...aKN.EDKKE.K..............................ET.R..R..A..RS...........R.......S..........RSKs...rAR..........SS..S.---....-......-..E....S....Q..........V.G..V.PPHlieYG..D.DP.VYG.R--........-I.........PA..S.N...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------graespyhtprkhthsrsrrspst....................................................................
A0A0F4YIE0_TALEM/493-600               ..................................RSSSR.........IR.D...L....AE....AG.L....A.A...A....G....V.G....Y.A..A....S...K..YA....ER.KEKKK.Kadk........................erhSR.E..R..E..RR...........R.......N..........ESD....rEH..........DS..Y.EEQ....Y......D..H....A....P..........Y.A..P.SPPv.gIA..G.EP.A--.E-N........YY.........PY..T.N...R.F...P........P....PPGA................HNL.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------geyrppps....................................................................................
A0A2D3UP02_9PEZI/307-348               ..................................RSRSR.........KR.E...L....AG....GA.L....-.A...G....V....A.-....-.A..A....E...V..YG....HH.RRQKG.D..............................KT.N..R..G..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------naig........................................................................................
A0A439DIZ4_9PEZI/407-474               ............................rsrsrsRSKSR.........SR.L...A....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YMq..nNK.IEKEE.S..............................HR.G..R..R..RR...........R.......Y..........SND.....--..........DY..S.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lsrspsrrg...................................................................................
A0A316VMK2_9BASI/62-125                ........................kkanrkktlg-----.........--.M...I....AV....AA.A....T.A...A....L....A.G....A.A..I....H...E..WE....KH.REAKQ.K..............................DS.K..E..E..KE...........T.......-..........QH-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------mpgefsdshhhqssgs............................................................................
A0A0D2CID4_9EURO/495-604               ................................keRSRSR.........IR.Q..aL....PV....IA.A....G.L...G....S....A.A....V.A..-....G...V..YE....KH.KAKKE.Aeeive...................knrrarSR.S..R..S..RA...........R.......S..........EH-.....-S..........AY..Y.DGP....P......A..P....P....T..........N.E..Q.SLV..eYG..N.TP.MYG.NN-........-Y.........GA..D.Y...Y.G...R........P....PPQD................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyysnavvp...................................................................................
A0A2B7XJD2_9EURO/398-518               .............rsksrsrrgekspgrikqglp-----.........--.-...-....--....--.I....V.A...A....G....L.G....T.A..Ai..tN...L..YE....KH.KEKKE.S.............................eSS.E..R..A..HR...........R.......K..........SRS.....RS..........RP..R.SSA....Y......S..D....P....S..........R.S..A.AGLv.eYG..D.DP.VYG.S--........-I.........PA..D.N...Y.Y...G........R....PPSR................QSSl.....pR--.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------aieaspsrnsrran..............................................................................
A2QKM3_ASPNC/301-373                   .........................rsrsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LR..........DT..H.EEK....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqr.........................................................................................
A0A4S3JBJ6_9EURO/519-651               ...............................rsk-PRSR.........SR.G...L....AE....AA.L....A.A...T....G....A.G....Y.A..A....H...K..YS....QH.KDRKK.A..............................EQ.D..R..D..RQ...........K.......Y..........DGR.....--..........DP..Y.DEA....Y......-..-....-....-..........-.-..-.SP-...SS..A.AP.QQI.ENQ........YY.........PN..S.N...F.F...P........P....PPGP................APR.......---.--....-QA....E..YATP......YNQ..AD...Y..P...PP......-GAV....P...S...S..Q..P.Y.N.Y..............PT................PPGPEPYA...PRPR.RADENV............................................................................................
C4JEK8_UNCRE/550-601                   ..........................lhqcrrqi-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..-KSH......ITP..AD...Y..P...PP......PGAP....P...P...P..Q..H.Y.H.Y..............AP................PTAQDPYA...PRQP.RGDENV............................................................................................
A0A0D2E8L9_9EURO/496-603               ..................................RSQSR.........VR.Q..aL....PV....VA.A....G.L...G....S....A.A....L.A..G....-...L..YE....KN.KAKKE.Aeli.......................akdgRR.A..R..S..RS...........R.......S..........RAR.....SD..........AY..Y.DGP....R......E..G....A....V..........S.D..P.GLI..eYG..N.GP.MYG.NN-........FG.........PD..Y.Y...G.R...P........P....PPEG................Y--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ygtsnavvp...................................................................................
A0A1J7I7S3_9PEZI/685-756               ..................................RSRSR.........LR.D...M....AA....GA.A....A.A...G....A....A.A....I.G..I....K...K..FQ...dNK.KEKEQ.K..............................ER.S..R..E..RS...........R.......H..........REE....rDR..........DR..D.RDR....D......R..D....R....D..........Y.G..S.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------drerete.....................................................................................
A0A2U1MVF2_ARTAN/209-282               ...................kkeqrmslgnpctcl-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...-M..G.QP.SLD.DYE........YY.........PK..S.N...Y.Y...A........K....PPNK................GRE.......--N.QH....RRS....F..ACLE......AVP..ADd.eY..T...QE......----....-...-...-..-..-.-.-.-..............--................--------...----.------qssaelself..................................................................................
A0A168JB54_MUCCL/900-942               ................................kr-----.........--.-...-....-D....AA.L....G.A...A....G....T.G....L.A..A....H...E..MK....DH.HDKKE.A..............................AS.N..R..S..S-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------vssvgsgekk..................................................................................
A0A395I4D9_ASPHC/298-360               ...........................rsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....NK.SNSKK.D..............................RR.S..R..S..RH...........R.......R..........A--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asstrslpvtkd................................................................................
G2QTJ0_THETT/700-864                   ..................................RSGSR.........LR.D...L....AA....GA.A....A.A...G....A....A.A....I.G..I....K...K..FN....ER.RAKEK.Ereekaea...............erekdrerNR.E..R..E..RD...........K.......G..........KER.....DR..........RR..Y.DAE....A......S..A....D....E..........Y.D..G.YGR..rGA..S.PP.NAS.GGF........YN.........PP..P.P...A.P...P........A....PPAGmn............gfTQH.......P--.NV....ATT....N..LHQQ......YTP..--...Y..P...GP......-GNV....D...F...T..A..-.-.-.-..............--................--------...----.------mpapppnsagvpdgapppfnpkdpeh..................................................................
E9DDF0_COCPS/510-672                   ..................................RERSR.........SR.D...L....AT....AG.L...aA.A...G....A....A.G....L.A..A....H...K..YA....QR.KERKK.N..............................ER.D..R..R..RD...........E.......G..........EA-.....RQ..........DS..Y.DDT....Y......S..T....T....P..........Y.P..P.SPP...RP..S.AS.LYP.QGN........YY.........PQ..T.T...Q.F...PqspnqttgP....PPGH................YQY......pPSN.YP....PPG....T..ASMPppnhvsHNP..AD...Y..P...PP......PGAP....P...P...A..Q..H.Y.N.Y..............PV................PPAQDPYA...HLQP.RGDENV............................................................................................
U7PSX9_SPOS1/496-646                   ..................................RSHSR.........LR.T...G....AE....IA.G....A.A...L....A....G.A....A.A..K....K...L..YD....KH.KDKKQ.L..............................ER.E..Q..K..EA...........A.......Y..........YSD.....DP..........YS..E.DDR....Y......S..R....Hg.rgS..........R.S..H.SRN...RS..A.AP.SQS.PPP........L-.........SG..A.T...R.T...P........Y....PPSG................A--.......---.--....DPE....L..GLVE......YGD..QP..lY..A...DP......----....-...-...-..-..-.-.-.-..............--................--------...----.------gapardgaivghrgsydsaadaserddrrarrrhrhsrn.....................................................
W6XRN4_COCCA/345-431                   ..................................RSKSR.........AR.E...L....GT....LA.A....I.A...G....V....G.A....L.A..Y....A...A..GQ....RN.KAKTK.Eetv.......................tiieDR.H..R..S..RS...........R.......H..........RSK.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srhrrgrrksrsvsvvsdrsrsrstskhmdpeh...........................................................
A0A370TQE2_9HELO/496-572               ..................................RSKSR.........IR.T...G....AE....IA.G....-.A...G....L....A.G....A.A..V....A...G..LY....EN.RKAKN.E..............................EK.E..A..E..ND...........R.......E..........ERR....lSR..........SR..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrarsigaysepgvdpelgmvqyg..................................................................
S3DTS4_GLAL2/454-537                   ................................rs--RSS.........SR.HshtK....VK....TA.Lg.laV.A...G....L....A.A....A.A..A....A...K..YV....SN.RNQNK.Ee............................lGR.G..R..S..RT...........R.......S..........RGR....gRS..........SS..Y.SSD....Y......G..S....R....A..........R.S..K.SV-...-H..T.DP.KH-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnat........................................................................................
B6H242_PENRW/542-687                   ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......H..........DDV.....HR..........DP..Y.EES....Y......D..P....E....P..........Y.P..P.SPQ..rAP..G.AP.PMA.DPH........YY.........PN..S.N...Y.F...P........P....PPGD................STY.......---.-N....LGG....G..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........avPP...............gGPGPDQYA...PRPR.RAEDNV............................................................................................
A0A135U1E0_9PEZI/645-691               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..L....K...Q..YQ....KK.KEKEE.E..............................IR.E..E..R..RS...........R.......E..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsa.........................................................................................
A0A1J9SBG8_9PEZI/458-590               .................................sRSRSR.........LR.T...G....AP....IA.A...aG.L...G....G....A.A....L.A..G....-...L..YE....KN.AGKKE.G..............................KK.E..R..K..AR...........S.......K..........SRS.....RS..........RS..R.SKS....R......-..-....S....R..........S.R..S.VPS...RS..R.RA.SAS.DPAl......vVY.........GG..D.P...I.Y...V........E....PSAS................GRH.......---.RR....SGS....A..GYDP......DDP..AD...Y..R...GRr....rPA--....-...-...-..-..-.-.-.-..............--................--------...----.------dsdsesdgrrrrhrs.............................................................................
A0A6P8BFX7_MAGGR/488-540               ................................rsRSRSR.........AA.S...V....AK....AA.A...gT.A...A....V....A.G....L.V..K....H...L..RD....KS.RARSG.-..............................GR.S..R..S..RS...........R.......S..........NSK.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sprr........................................................................................
S3DTS4_GLAL2/755-867                   ................................sg-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......Y..........EEE....pPD..........DY..Y.SRD....Y......V..D....D....G..........Y.S..P.SP-...--..-.-P.HAS.GGS........FY.........PD..H.N...Q.F...Q........P....PQQPayt..........pgfTQH.......-PN.LS....TPN....V..GQSPl...ptYNP..AD...Y..A...PGt....gPAPQ....P...P...H..D..P.Y.G.Y..............PPt..............vPRSGDNVS...PRTT.------thqy........................................................................................
A0A2T2NGB3_CORCC/452-534               ..................................RSRSR.........VR.Q...G....IP....IA.A....-.A...G....V....T.G....A.A..I....T...G..LY....ER.QKAKK.Eake........................lsrSR.S..R..S..RS...........R.......S..........RSR.....SR..........SV..H.SSA....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrstasdsalveyggdpiytdp......................................................................
A0A059J342_TRIIM/567-700               ..................................RSRSRhgn...gnlAA.G...L....AA....AG.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......Y..........DRD.....YR..........DP..Y.EEE....Y......-..P....S....P..........P.G..P.PPG..pAS..Y.QP.PAA.QE-........YYgap..ppgpPG..G.R...G.Y...P........P....PPGP................---.......---.--....---....-..---P......--P..GP..gY..F...GG......PGP-....-...-...-..-..-.-.G.G..............PP................VYRGDENV...PQPS.RQHQN-g...........................................................................................
A0A0D1Z4Z7_9EURO/479-597               ..................................RSRSR.........IR.Q..aL....PV....VA.A....G.L...G....S....A.A....V.A..-....G...L..YE....KH.KAKKE.Aeeiad...................drrrarSR.S..R..S..RA...........R.......S..........EH-.....--..........AY..Y.DGP....G......Q..G....A....V..........N.D..P.GLI..eYG..N.AP.MYG.NN-........YG.........AD..Y.Y...G.R...P........P....PPDG................YYS.......NAV.VP....AA-....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tgpaagygaq..................................................................................
A0A1Y2EBN1_9PEZI/495-556               ................................rsRSKSR.........SR.L...T....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YMq..sNK.IEKEE.A..............................TR.G..R..S..RR...........R.......Y..........SGS.....--..........DS..S.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrthsr.....................................................................................
A0A1B8CI28_9PEZI/513-651               ..................................RSRSR.........AR.D...V....LG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RH...........-.......-..........YSS.....--..........DS..Y.PSS....R......R..S....A....D..........Y.S..P.SP-...--..-.-P.HAS.GGA........YY.........PN..H.S...T.Q...P........Ps..hPYAP................TPDah...pyPDT.NH....Y-G....V..HPDP......NAP..TA...F..P...PP......PVP-....-...P...S..G..A.Y.H.A..............PPn..............gG-------...----.------yeaqsahsgpap................................................................................
A0A179F7R8_METCM/464-564               ..................................RSKSR.........LR.R...V....AE....IG.G....V.A...A....A....A.G....V.A..N....K...L..WK....NH.KEKKE.Ntrdlsasg.............ddeyyrrrdS-.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrhrsvsggrhrsrsrsmarspyaqpgadpelglveygndplypesr............................................
A0A673LV53_9TELE/292-416               ...........................eaierar-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....R...E..VE....QRaRDLR-.-..............................EK.E..R..E..RD...........R.......E..........KER.....-E..........RD..L.DRH....F......Q..Q....K....D..........S.C..T.SAG..lGA..T.AT.HQS.SSL........FF.........PS..S.S...S.I...L........L....DPSS................SSS.......SSV.NP....SHP....A..AHPQ......YHP..AH...H..A...SH......PHSI....H...P...S..H..P.L.H.H..............--................--------...----.------slshsiphslllps..............................................................................
K9FWG0_PEND2/304-377                   ...........................rsrsrsh-SHSR.........VK.T...L....IE....LG.V....G.A...Aa..vA....A.G....V.A..A....L...H..SK...sKA.EERKD.R..............................SR.S..R..T..RT...........R.......-..........-SR.....S-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rafsrgrsekdgdhgersm.........................................................................
A0A0F4GXD0_9PEZI/303-351               ..............................rsrsRSQSR.........KR.S...L....AT....GA.L....-.-...A....G....A.G....A.A..A....I...L..GQ....HR.KKQGH.E..............................ES.H..R..G..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nvlgga......................................................................................
A0A074WG27_9PEZI/325-402               ..................................RSRSR.........AR.T...L....AK....VG.T....V.A...A....V....G.A....L.A..A....Y...A..LR....NR.GNKET.Vivnn.....................elpppRR.S..R..S..RR...........R.......R..........S--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svgsapppldarnrsrseskhrdp....................................................................
A2QKM3_ASPNC/397-504                   .............................rsrsrRRESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPG..lIE..Y.G-.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dhpvhgsippnyygrpvsphgyysdasd................................................................
A0A1B8ESY3_9PEZI/555-711               ..................................RSRSR.........AR.D...V....LG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RH...........-.......-..........YSS.....--..........DS..Y.PSS....R......R..S....A....D..........Y.S..P.SP-...--..-.-P.HAS.GGA........YY.........PN..H.S...T.Q...P........PshpyPPTP................DAHp.....yPDA.NH....YG-....A..HPNP......NAP..TA...F..P...PP......PVP-....-...P...S..G..A.Y.H.A..............PPn..............gG--YEA--...----.------hsthsgpapggpagpghvnpdyygeta.................................................................
A0A1S8B208_9PEZI/590-641               ..................................RSRSR.........SR.A...V....AE....AA.A....L.A...G....V....A.G....V.A..A....H...E..AA....KR.RERKK.A..............................DK.K..E..R..KR...........K.......F..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srmfqspn....................................................................................
A0A1L7X6W7_9HELO/641-789               ..................................RSRSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.KEKKE.A..............................ER.E..R..E..RR...........R.......Y..........EEE.....APp........eNY..Y.ARN....Y......A..D....E....G..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PQ..N.N...E.F...P........P....PPQApa............gfTHHg.....nQST.PH....VNE....T..NIPP......YNP..AN...Y..A...NQ......--AP....P...H...V..D..P.Y.G.Y..............PP................QNHPGDNV...SN--.------ettsrqtp....................................................................................
A0A484G583_COLOR/53-173                .......................drgyprdrass-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....-R.DRPIN.R..............................ER.E..R..D..RR...........R.......Y..........DEA.....PR..........EG..Y.YDD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGA........Y-.........--..-.-...-.Y...P........P....PAATsa............sfTQH.......PNI.ST...tNLR....D..TYPP......-YP..QD...Y..P...TP......PMAT....G...G...A..-..-.G.G.Y..............PP................PP------...----.------pggpppaggppsttrfgp..........................................................................
S2JHI7_MUCC1/200-279                   ............................dhhykr-----.........--.-...-....-D....AA.L....G.A...G....T....A.G....L.A..G....H...E..MK....NH.HDHQS.G..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lnnhhassnplqpglghnnyegaidnplqsetdklhqsskdndhhykrd...........................................
A0A2K1R052_9PEZI/612-761               ..................................RSRSR.........TR.G...L....AE....AA.A....A.A...G....V....A.G....A.A..A....H...H..IT....KK.NERKR.V..............................EK.E..R..R..RR...........E.......R..........EEE.....--..........--..Y.AQE....-......-..-....Q....Q..........Y.T..P.PPM..gPN..A.GP.YTP.QQD........YY.........PQ..S.N...S.F...P........P....PPTN................AAY......dSRD.PN....YPP....E..QYPP......YNP..AD...Y..P...PP......PGTT....P...Q...P..G..V.D.Q.Y..............PA...............sPNDQYNYA...PN--.------etfagdpryddrqy..............................................................................
W9XB18_9EURO/486-592                   ..................................RSRSR.........VR.Q..aL....PV....VA.A....G.L...G....S....A.A....V.A..-....G...L..YE....KH.KAKKE.Aee.........................ivdER.R..R..A..RS...........R.......S..........RSRa..rsEH..........AY..Y.DGP....N......Q..G....A....I..........N.D..P.GLI..eYG..N.AP.MYG.NN-........YG.........PD..Y.Y...G.R...P........P....PQ--................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dgyysnavvp..................................................................................
A0A2J6QGU0_9HELO/512-601               ..................................RSKSR.........IR.T...G....AE....IA.AaglaG.A...G....V....A.G...lY.E..G....R...K..AK....EE.RDEAE.H..............................EA.R..R..E..RR...........K.......S..........RSR.....SR..........AR..S.VGA....Y......S..D....P....G..........V.D..P.ELGmvqYG..T.EP.VYA.HPG........YY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dpa.........................................................................................
A0A1G4B989_9PEZI/512-640               ..................................RSKSR.........IR.T...G....AE....IA.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KEKKD.Re............................iDR.E..L..D..EQ...........D.......Y..........EEE....vRR..........ER..R.ERR....R......S..R....S....R..........S.Q..A.-RS...LY..S.EP.RSA.DPElg...lveYGt.......ePL..P.S...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......MSG..DD...Y..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dghepak.....................................................................................
W9XLQ4_9EURO/630-790                   .............................rskhgR-RRS.........SH.D...A....AK....MA.A....A.A...G....A....G.A....I.A..A....T...E..YE....KR.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........EEG....yAG..........DP..Y.EDN....Y.....hP..S....Q....P..........Y.P..P.TPP..pPV..N.DP.YAA.QQG........FY.........PQ..T.S...Q.F...P........P....PPGS................VPQq.....yPPQ.QP....PPT....A..GPAAg....tSYP..TQ..pY..P...PP......PPAG...gP...P...P..T..T.N.P.Y..............DA...............yGSGANPYP...PRG-.------penvsde.....................................................................................
M2ZPK6_PSEFD/811-967                   ..................................RSRSR.........RR.N...L....AE....AG.A....A.A...G....V....A.A....V.A..A....H...E..IG....KR.RERSR.A..............................SR.S..R..E..RR...........R.......P..........ED-.....--..........DY..Y.DDR....R......A..D....D....P..........Y.A..P.PPM..gNS..Y.PP.YQN.NDPya....qqAY.........PG..A.N...Y.F...P........P....PPNG................ETS.......GYV.EP....QPA....Y..AHAQ......YNP..AD...Y..A...GQ......PATQ...aP...Y...D..H..Q.Q.A.Ydg..........ygEPy..............pGQSHHNYA...RDTQ.Y-----gdegr.......................................................................................
A0A4T0VLI6_9PEZI/626-669               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KR.KEKDE.D..............................RR.S..R..E..RA...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sr..........................................................................................
A0A2S6CI98_9PEZI/665-829               ..................................RSKSR.........KR.H...L....AE....TG.A....A.A...G....V....A.A....V.A..A....H...E..IG....KR.RERNR.Srd..........................srSR.S..R..S..RS...........R.......P..........GAR.....RD..........DD..Y.YDD....R......R..D....D....P..........Y.G..P.PPM..gQS.dY.PP.YQN.NNPypq..ggqAY.........PS..S.H...Y.F...P........P....PPNA...............dYNQp.....rGNI.EP....QPE....Y..AHAP......YNP..AE...Y..A...GQ......PATQ...qP...Y...D..N..Q.Y.AgY..............GE................QYPADAYA...GDQR.YAR---dph.........................................................................................
E5AFM9_LEPMJ/591-727                   ..................................RSKSR.........AR.S...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDKKK.A..............................EK.E..R..E..RR...........R.......E..........DDS.....--..........AY..S.TGT....Y......S..P....G....S..........Y.D..S.PRS...ST..V.HP.NDS.R--........FF.........PE..T.N...Y.F...P........P....PPSA................---.......-PV.DH....ATT....T..PYPP......YNP..AD...Y..P...PP......PQTA...yE...P...Q..H..P.S.H.Fv...........nhPP................PPPHDMNY...GNP-.------............................................................................................
A0A1V6TKK6_9EURO/714-790               ................................eg--RSR.........SR.E...I....SS....AA.L....G.A...T....G....L.G....Y.A..A....H...T..YS....QQ.KDCRR.-..............................SE.E..R..E..LF...........K.......E..........KEK.....KV..........EV..S.RKR....Fr...syS..D....D....D..........D.D..D.AP-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rgrtrtrynr..................................................................................
A0A094JE74_9PEZI/550-621               ..................................RSRSR.........AR.D...V....IG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RR...........A.......Y..........TPE.....-I..........TL..S.SAH....L......-..P....T....P..........P.-..I.SPS...TP..F.SP.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ahtn........................................................................................
G3JMF7_CORMM/325-456                   ..........................rkssgggf-----.........MK.T...L....AT....VA.A....A.V...G....A....G.G....L.A..A....N...F..MK....KR.NNREE.Eys..........................avST.D..T..P..RR...........N.......R..........SGR....gQP..........SD..Y.GSE....Y......-..T....D....D..........Y.T..A.TQT...SL..L.PP.SAN.PAT........TYtt.....rtTG..D.T...G.R...P........T....TPRS................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sypsrrdhdesdyssyvspshrrpaensgg..............................................................
A0A2I2G2G6_9EURO/531-669               .................................l--RSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS...sHR.KDRKK.E.............................kER.S..R..E..RL...........R.......F..........DER.....--..........DS..Y.DDP....Y......R..H....E....P..........Y.S..P.SPS...TA..P.PP.M--.DNQ........YY.........PN..S.N...Y.F...P........P....PPGS................APR.......---.--....-PA....E..NVAP......YNP..AD...Y..P...PP......PGAV....P...P...V..Q..P.Y.G.Y..............GT................PPAPEPYA...PRPR.RADENV............................................................................................
A0A5N6TGK4_9EURO/367-471               ..................................RSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KGKKE.Eeegaegs...............lgrgerrrS-.-..R..S..RS...........R.......A..........RSE....mCP..........DP..S.RDS....A......G..L....I....E..........Y.G..Q.DPV...HG..R.IP.AAD.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------yygrpisqhgyysdasd...........................................................................
M7U351_BOTF1/694-842                   ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YR....KR.KEKKE.Kkekk.....................daekhER.E..R..E..RR...........R.......Y..........EDE.....AP..........ES..Y.YTN....F......R..D....E....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...A.F...P........P....PPTSnpet........ftnhGNKs.....tPFV.NE....IP-....-..PIPP......YNP..QD...Y..A...SQ.....rPTTH....D...P...-..-..-.H.H.Y..............PP................S-------...----.------srvpgdni....................................................................................
S2JHI7_MUCC1/359-418                   ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....DH.HGKES.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------glenhhttsgnplhsgsnnvnhsvndnndhhykr..........................................................
A0A1B7P428_9EURO/371-480               .......................kspsrvkqgip-----.........--.-...-....-I....AA.A....G.L...G....S....A.A....I.-..A....N...L..YE....KH.KEKKK.E..............................SE.S..S..E..RQ...........D.......K..........KHR.....RR..........SR..S.RSM....G......R..S....S....T..........Y.P..D.PSR...SA..P.QL.IEY.GDD.......pVYg......siPA..E.N...Y.Y...G........R....PPSR................PAS.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------praieasprrss................................................................................
C1GDB7_PARBD/373-473                   ..................................RSRSR.........IR.Q..gL....PI....AA.A....S.L...G....S....A.A....I.A..-....G...L..YE....KH.KEKKE.N..............................ES.S..E..R..HH...........R.......H..........RSR....sRS..........VA..P.SSA....Y......-..S....D....P..........S.G..S.APQlieYG..D.DP.VYG.S--........-I.........PT..N.H...Y.Y...G........R....P---................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssrqsspraiess...............................................................................
A0A5N5K296_9PEZI/559-701               ................................ksRSRSR.........LR.T...G....AE....IV.-....G.A...G....L....L.G....A.A..G....K...K..LY...dRH.QDKKE.R..............................ER.E..R..E..LS...........E.......E..........ED-.....--..........EY..Y.RDH....H......D..D....R....R..........H.R..S.RSR..sVG..S.RS.AAA.RPT........PY.........PE..G.R...-.-...P........A....DPEL................---.......GMV.--....--E....Y..GAHPl....ySDP..AP...Y..P...EH......AGYG....A...P...R..G..A.A.G.Y..............ESa..............gEDGRRRHR...SRR-.------rrdvdes.....................................................................................
W9XLQ4_9EURO/485-605                   ................................keRSRSR.........IR.Q..aL....PV....VA.A....G.L...G....S....A.A....L.A..G....-...L..YE....KN.KAKKE.Aeki.......................stegRR.A..R..S..RS...........R.......S..........RAR.....SD..........GY..Y.DGP....R......D..A....A....L..........A.D..P.GLI..eYG..T.GP.MYG.NN-........FG.........PD..Y.Y...G.R...P........P....PAEG................Y--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ygasdavvprdpytaqrgar........................................................................
W9W1E3_9EURO/534-675                   .................................k-NKNR.........LQ.D...V....AS....IG.I....A.A...L....G....L.K....G.A..Y....S...E..WQ....ET.REAQR.E..............................QK.E..E..K..EK...........R.......E..........RHK....aKRa.......arRR..K.MSM....I......A..A....H....N..........Y.V..D.SGF...TG..S.MP.NLA.SYPq.....qqYP.........PQ..Q.P...T.F...P........P....PPGA................FAY.......---.--....---....-..--GT......GSP..VH...Y..A...DD.....nPYG-....A...I...S..Q..Q.Q.A.Y..............VP................APHHEPQV...GVPR.A-----eth.........................................................................................
U7PSX9_SPOS1/670-732                   ..................................RSRSR.........LR.N...L....AT....AG.A....G.A...A....A....A.A....I.G..I....K...K..YS....DS.KKKKE.E..............................EA.N..R..R..DR...........R.......D..........HE-.....RD..........RD..H.DRD....F......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------drdhdrqr....................................................................................
A0A1C1CLL1_9EURO/643-802               ...............................rgg--RRH.........SR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....S...E..AE....RR.KQERR.E..............................RR.A..R..R..RQ...........Q.......E..........EGY.....GR..........DP..Y.EDN...nY......N..P...gG....Q..........Y.A..P.TPP..pPA..H.DP.YAT.QQG........FY.........PQ..S.S...Q.F...P........P....PPGS................IPQq.....yPPQ.AG....PGM....A..PPPPgs..apYGQ..QG...Y..P...PPp....pPPGA....P...P...P..P..A.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsa......................................................................................
A0A1L9MUX9_ASPTC/302-372               ...........................rsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LK..........DS..H.EET....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqr.........................................................................................
A0A2D3UP02_9PEZI/643-800               ..................................RGHSR.........AR.N...L....AA....GA.A....V.G...G....A....A.G....A.A..A....H...E..YG....RR.RERSR.V..............................VN.E..N..R..RR...........-.......-..........DD-.....--..........DY..Y.GNS....Lr....eQ..E....E....P..........Y.S..P.PPMggnGF..Q.QP.PYQ.QQQ........TY.........PS..S.H...Y.F...P........P....PPTG................DVA.......RND.GY....GAP....T..SYPT......YNP..AD...Y..A...GQ......PAQQ...hP...Y...D..A..-.-.S.Y..............GG................YGGSDANM...GQPH.HGD---ahagvdrqnashdn..............................................................................
A0A319A1B2_9EURO/268-329               ...........................rsrsrsh-SHSR.........VR.T...L....AE....LG.L....G.A...AaiagA....V.A....L.A..R....N...K..SN....SN.KDRR-.-..............................SR.S..R..H..RR...........A.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asstrslpltk.................................................................................
A0A072PTE1_9EURO/632-778               .................................h-SRRR.........SR.D...A....AK....YA.A....A.A...A....A....G.A....I.G..T....S...E..YN....RR.KEEKR.-..............................ER.K..A..R..RQ...........E.......E..........EAAy...rAH..........DP..Y.EDS....Y.....nT..G....A....P..........Y.A..A.TP-...--..-.DP.YAA.QQG........FY.........PQ..T.S...Q.F...P........P....PPGG................MPG.......-QY.NP....QPA....A..TQMPga..apYGG..QV...Y..P...PP......PAGP....-...P...P..V..T.N.N.Y..............DA...............yASGANPYA...PRG-.------penvs.......................................................................................
A0A0N0NRB6_9EURO/461-591               ..........................rsksrgrdRSRSR.........VR.Q...A....AP....V-.-....V.A...A....G....L.G....S.A..A....-...-..LA....GL.YERNK.A..............................KK.E..A..E..VI...........R.......K..........EEK.....GR..........CF..S.DPN....L......-..-....I....E..........Y.G..D.GPMh.gNN..Y.GP.DYY.GRNlp...qenFY.........AN..Q.T...A.V...V........P....APGQ................SPG.......APA.QY....AQR....D..LS--......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------peysnrrsrsrsrstsp...........................................................................
A0A2P7ZDN6_9PEZI/383-456               ..................................RSKSR.........AR.Q...L....GG....VA.A....V.A...A....V....G.A....L.A..G....Y...A..LR....NR.NKQQQ.Ii............................eRR.S..R..S..RR...........R.......R..........GSM.....SS..........DE..V.TVE....R......A..R....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sanaqtdskprtnr..............................................................................
A0A136J136_9PEZI/665-772               ..............rsrarsrdmsrdrsrsrsvd-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...A..RS....DR.KSRGR.L..............................SR.D..R..E..RR...........R.......Y..........EEE.....--..........-A..D.ADR....Y......-..-....D....D..........Y.D..A.PP-...--..-.SP.LHA.S--........--.........-G..G.A...Y.Y...P........P....PPGP................PPG.......--H.LP....QAG....Y..GASP......YPP..AG...A..P...PP......AAAY....P...P...R..D..-.-.-.-..............--................--------...----.------pgnm........................................................................................
G4N0D9_MAGO7/539-644                   ................................rhRSRSR.........LR.T...G....AE....IV.A....-.A...G....L....A.G....G.A..A....K...K.iYD....KH.QEKKE.R..............................ER.S..R..S..VA...........A.......G..........KRRs..rsRS..........LS..S.DWS....Y......D..D....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rdrrrrsrshsrsnararlpplphndssradselgmveygnnp.................................................
A0A4Q4WVB9_9PEZI/560-619               ..................................RSRSK.........LR.N...V....AA....GV.L....G.T...G....A....A.A....I.G..I....K...K..YQ....DH.QKSKG.H..............................EQ.E..E..R..RR...........S.......M..........SRD....aSR..........NR..S.Q--....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------drdrag......................................................................................
A0A5N6FP34_PETAA/529-576               ..................................RHHSR.........TR.G...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKE.A..............................EK.D..R..E..RP...........S.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ewpsr.......................................................................................
A0A5N7BNB9_9EURO/416-515               ..................................RSHSR.........LR.K...A....LP....--.V....I.A...A....G....L.G....T.A..Av..tG...L..YE....KH.KEEKE.Kgea.......................ssrrER.S..R..S..RS...........R.......A..........LSK....iYP..........DP..E.RDS....A......G..L....I....E..........Y.G..Q.DPV...HG..R.IP.TAD.---........YY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grptsqqayysdasdp............................................................................
A0A080WQ72_TRIRC/489-609               ..................................RSRSRhgn...gnlAA.G...L....AA....AS.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......Y..........DRD.....YR..........DP..Y.EEE....Y......-..P....S....P..........P.G..P.PPG..pAS..Y.QP.PAA.QE-........YYgvpp.ppgpPG..G.R...G.Y...P........P....PPGP................PP-.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gpgyfggpgpggppvyrg..........................................................................
A0A074YPM7_AURSE/540-696               ..................................RSRSR.........TR.G...L....AE....GA.A....A.A...G....V....A.A....V.A..A....H...E..LG....KR.DERRR.Sd............................rDR.D..R..E..RR...........R.......R..........DED.....-E..........DM..Y.ARD....R......-..-....-....P..........Y.S..P.PPMganAA..Y.PP.TPQ.NQD........FY.........PA..T.N...S.F...P........P....PPTD................-NY.......GRE.AD....YPP....H..EYPP......YNP..AD...Y..P...PP......PGAA....P...AprgR..H..N.D.R.Y..............SPdpn..........lgyPPANETFA...GDTR.YAG---dtr.........................................................................................
A0A5N6TGK4_9EURO/520-656               ..................................KNRSR.........SR.D...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKR.A..............................EQ.D..R..P..RF...........-.......D..........DDT.....RQ..........DS..Y.DDP....Y......G..S....E....P..........Y.P..S.AL-...--..-.PP.PRQ.NDQ........NY.........PS..G.N...Y.F...P........P....PPGS................APR.......---.--....-TA....G..SAAP......YNP..AD...Y..P...PP......PGAV....P...P...S..Q..S.Y.G.Y..............PP................PPGPEPYA...TRPR.RADENV............................................................................................
G2QTJ0_THETT/535-639                   ................................ksRSRSR.........LR.T...G....AE....ML.A....-.A...G....L....A.G....A.G..A....K...K..LY...dRH.KEKKE.A..............................ER.D..R..D..RG...........Y.......S..........DDE.....--..........-Y..Y.EDD....A......R..D....-....-..........Y.N..R.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrsrslsrsgptypdgdpsaadpelgmveygahplyanpaypad...............................................
A0A139HNL3_9PEZI/431-506               ............................rsrsrsKSLSR.........RQ.Q...L....GG....LA.A....V.A...G....V....A.A....L.A..G....Y...A..LN....KN.KNKET.Iivn.......................dghrRR.S..R..S..RR...........R.......R..........HSV.....--..........DT..Y.ISD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------eerehrdpgh..................................................................................
A0A5N5XDY5_9EURO/553-690               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKK.V..............................DK.E..R..E..GP...........R.......F..........DDD....aRQ..........DS..Y.DEP....Y......S..T....E....P..........Y.P..P.SP-...--..-.-P.QPN.EHQ........YY.........PN..T.N...Y.F...P........P....PPGI................APR.......---.--....-PA....G..STAP......YNP..AD...Y..P...PP......PGAV....P...P...S..Q..S.F.G.Y..............PP................PPGPEPYA...SRPR.RADENV............................................................................................
A0A2P7ZDN6_9PEZI/610-758               ..................................RSRSR.........TR.G...L....AE....AA.A....A.A...G....V....A.G....A.A..A....H...H..LT....KK.NERKR.A..............................EK.E..R..R..RR...........E.......R..........EDE.....--..........--..Y.AQE....-......-..-....Q....P..........Y.T..P.PPM..gPN..A.GP.YTP.QQD........YY.........PQ..S.N...S.F...P........P....PPTN................AGY......dTRD.PN....YPP....G..EYPP......YNP..AD...Y..P...PP......PGTT....P...Q...P..G..V.D.Q.Y..............PA...............sPYDQHGYA...PNDT.------fagdpryddrq.................................................................................
A0A7C8MR54_9PEZI/397-464               ............................rsrsrsRSKSR.........SR.L...A....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YM....QN.NKIEK.E..............................ES.H..R..G..RR...........R.......R..........RHS.....NG..........DY..S.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lsrsssrrg...................................................................................
A0A168JB54_MUCCL/191-228               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKE-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sglegthhtsgnp...............................................................................
A0A319DWF9_9EURO/371-468               .................................r-GRSR.........SH.S...T....LR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................DE.T..R..R..RE...........R.......R..........RSR....sRS..........RA..A.SDT....Y......-..P....E....H..........T.R..E.SPGlieYG..D.HP.VQG.NIPa......nYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpvtphgyy..................................................................................
A0A136J136_9PEZI/486-567               ..................................RSKSR.........IR.T...G....AE....IA.A....-.A...G....L....T.G....A.A..A....S...K..LW....ER.QKDKK.D..............................KK.E..H..H..RS...........Rdr...dfV..........EDDy...vRH..........RS..Y.SRS....Q......S..R....S....R..........S.R..V.RSL...DS..R.QP.TA-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nrel........................................................................................
E3QDR6_COLGM/691-829                   ..................................RSRSR.........DR.S...V....SR....PR.A....H.S...R....D....R.A....Y.S..R....E...R..ST....DR.PINR-.-..............................DR.E..R..D..RR...........R.......Y..........EEG....vRD..........DE..Y.YTD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GG-........--.........--..-.S...Y.Y...P........P....PPAAaa............gfTQY.......PNIsTA....NLR....E..QYPP......-YP..QD...Y..P...PG......PPPM....G...P...S..P..P.M.A.-..............--................--------...----.------tggaggyppppaggpppsgglpp.....................................................................
S2K5A6_MUCC1/218-326                   ............................sgmssg-----.........-M.K...M....AG....AA.A....V.G...V....A....G.G....L.A..I....G...S..IM....HH.EEEQS.-..............................--.D..R..I..ER...........L.......E..........QEQ.....RQ..........LE..Q.QQQ....Y......N..Q....Q....P.........sY.S..A.PP-...--..-.-P.PQE.Q--........Y-.........--..-.-...N.A...P........P....PPME................-QQ.......---.--....PYD....G..GYGN......YNP..GD...Y..Q...QQ......DGGG....-...-...-..-..-.-.-.-..............--................--------...----.------dtqttiire...................................................................................
A0A5N6EDR8_9EURO/306-377               .........................rsrsrshsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..R..RS...........R.......S..........RHH.....RS..........SS..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------vrsgrttdgekrs...............................................................................
A7EI77_SCLS1/616-790                   .........................ydrtnehds-----.........--.-...-....-A....VA.A....A.A...A....G....A.A....Y.G..A....S...R..RS....RS.RSRQR.Krdsssdd................ekrprsrS-.-..R..S..QS...........RvrdlaagY..........EDE....aSP..........ES..Y.YTN....F......R..D....D....T..........Y.S..P.SP-...--..-.-P.HAS.GSS........YY.........PD..N.N...Q.F...P........P....PPTSvpqg........ftrhGNQs.....sPFV.NE....IP-....-..PIPP......YNP..QD...Y..A...GR.....rPSTH....E...P...H..-..-.V.N.Y..............PP................------YP...PSS-.------ripgdnvnrlnnstpttpv.........................................................................
A0A364L5S8_9EURO/478-621               ..................................RSSSR.........IR.D...L....AE....AG.L....A.A...A....G....L.G....Y.A..A....S...K..IS...gNK.KDKSR.H..............................SR.E..R..E..SR...........R.......H..........DHE.....-N..........DS..Y.EEP....Y......D..P....A....P..........Y.M..P.TP-...PP..G.AP.VPP.TES........YY.........PY..T.N...S.F...P........P....PPGS................TPN.......P--.--....---....-..PPAS......YHP..RE...Y..P...PPp....aPGAV...pP...P...M..H..-.-.G.Y..............PPpp............gaPPGNEPYA...PQPR.RADENV............................................................................................
A0A507QN43_MONPU/297-352               ..................................RSHSR.........SK.T...L....TE....LG.L....G.A...A....A....V.A....G.A..M....A...L..A-....--.RSKSH.S..............................GR.G..R..S..RS...........R.......H..........HHH.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sssnrhggsvdd................................................................................
M2MVN7_BAUPA/433-520                   ............................rsrsrsKSLSR.........AQ.Q...L....GG....LA.A....V.A...A....V....G.A....L.A..G....Y...A..LT....RN.KNKET.Vvv.........................eppHR.S..R..S..RR...........R.......R..........ASV.....-D..........SY..Y.TDD....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tvlsdgggramdpnhrntriaq......................................................................
A0A0D2DS24_9EURO/379-467               ................................rrRSRSRses...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKNK.Nnd.........................dddRR.G..R..S..HS...........R.......S..........RSR.....RR..........AE..S.VSS....L......E..N....D....P..........D.A..P.SD-...DA..R.NP.KH-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrnt........................................................................................
B6Q8Z7_TALMQ/499-641                   ..................................RSSSR.........IR.D...L....AE....AG.L....A.A...A....G....L.G....Y.A..A....S...K..IS...gNK.KDKSR.H..............................SR.E..R..E..SR...........R.......H..........DHD.....-N..........DS..Y.EEP....Y......D..P....A....P..........Y.M..P.TPS..pGA..P.GP.PTE.N--........YY.........PY..T.N...S.F...P........P....PPGS................TPN.......---.--....---....L..PPTS......YHP..GE...Y..P...PPp....aPGAV....P...P...M..H..E.Y.P.H..............PPg..............aPPGNEPYA...PQPR.RADENV............................................................................................
W3XH82_PESFW/412-479                   .................................d-HRSR.........DA.A...L....G-....AG.A....A.T...G....V....A.A....Y.G..M....H...E..YN....KY.KEPSA.-..............................SR.K..P..V..GS...........G.......V..........D--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sthldsrtspsgdhrdpqsasrdhi...................................................................
A0A3N2Q3M1_9PEZI/652-711               ..................................RSRSR.........LR.N...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...E..YK....RR.KEREK.E.............................aEE.D..A..E..RR...........G.......K..........GRQ.....RD..........PS..V.DTD....Y......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ard.........................................................................................
F0U958_AJEC8/562-700                   ..................................RSRSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKR.A..............................EK.D..R..R..TY...........A.......H..........DHD.....YS..........DS..Y.EDG....Y......E..P....A....P..........Y.P..P.SP-...--..-.-P.SNG.PN-........YY.........AQ..G.S...Q.F...P........P....PPGA................APV.......P--.--....PPN....V..QPGP......YNP..AD...Y..P...PP......PGAA...pQ...P...P..S..N.Y.P.Y..............PP................PPGVDAYA...PRSA.RGDENV............................................................................................
A0A2V1C4F1_9HELO/626-771               ..................................RSRSR.........VR.N...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.KEKKE.M..............................DR.E..R..E..RR...........R.......Y..........EEE....pAP.........eNY..Y.ARD....Y......-..Q....D....D..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...A.F...P........P....PPQPqp...........gftT-Ht.....tTST.TH....VNH....E..GIPP......YNP..AD...Y..A...DQ......PPH-....-...-...P..D..P.Y.G.Y..............PP................QTGHNVSA...NDNT.------shqap.......................................................................................
A0A1F7ZZU3_9EURO/563-614               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKK.Dlm.........................rihA-.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rtrmanrtaln.................................................................................
A0A5M9JK00_MONFR/761-880               ................................ek-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....Q...E..KR....ER.RDAEK.H..............................ER.E..R..E..RR...........R.......Y..........EDE....aSP..........ES..Y.YTN....F......R..D....D....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...Q.F...P........P....PPTSapdt........fthhGNQs.....tPFV.NT....IP-....-..PIPP......YNP..QD...Y..A...GQ.....rPVH-....-...-...D..T..H.V.H.Y..............PP................VS------...----.------rtpgdni.....................................................................................
W2RLM0_9EURO/664-811                   ..................................RRRSS.........RR.R...V....AE....AG.A....A.A...A....A....G.A....A.G..A....S...M..YE....RS.KQEKR.-..............................ER.K..A..R..KR...........R.......E..........QEQ.....YG..........DP..Y.EEG....Y......N..P....Q....A..........S.H..A.PP-...-P..S.DP.YGA.PPQp......gYY.........PE..S.G...A.F...P........P....PPGA................GQY.......---.AP....DPA...aQ..QAGN......YMQ..QG...Y..P...PP.....pPGGPg..mP...P...P..P..G.V.G.Y..............EP...............yASGANPYA...PPR-.------gadnvr......................................................................................
A0A395GJ13_9EURO/404-506               ..................................RHESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RD...........R.......R..........RSR....sQS..........RA..P.SEA....Y......-..P....D....P..........T.R..A.SPGlieYG..D.HP.VQG.SIPa......nYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpmsphgyysdasd.............................................................................
A0A1B7P428_9EURO/268-337               ...........................rhrsrss-SDSR.........VK.T...L....AG....LG.LgaaaI.A...G....V....V.A....L.A..R....K...K..SQ....KN.AEKSN.N..............................-N.S..R..D..RR...........S.......R..........SRR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrgsasssndaass..............................................................................
A0A1L9MUX9_ASPTC/555-694               ..................................KHRSR.........SR.E...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.D..R..D..RP...........E.......S..........DED....aRR..........EP..Y.DNS....Y.....kT..P....L....P..........Y.P..A.TPA...AA..P.RP.VDD.HQ-........YY.........PN..G.N...Y.F...P........P....PPAT................GPR.......P--.--....---....-..EPAP......YSP..AD...Y..P...HP......PGPV....P...P...-..Q..S.Y.E.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
A0A1J9Q7U5_9EURO/412-520               .................................k-SPSR.........IR.Q...G....IP....IA.A...aG.L...G....S....A.A....I.-..A....N...L..YE....KH.KEKKE.-..............................SE.S..A..E..RQ...........D.......K..........KHQ.....RR..........AR..S.RST....G......R..S....S....A..........Y.A..N.PSR...SA..P.QL.IEY.GDD.......pVYg......siPT..D.N...Y.Y...G........R....PPSR................QSS.......P--.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------raieasprrss.................................................................................
A0A2J6SZQ0_9HELO/569-699               ............................pptasd-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.S..M....E...R..YE....KR.KNEKE.S..............................SR.E..R..E..RM...........R.......Y..........EEEe...sSS..........RY..Y.ERN....Y......H..D....E....N..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...Q.F...P........P....PPSG................SLI......qKFV.NM....KVA....R..PVPP......HNL..AD...Y..T...RI......PPA-....-...P...D..D..P.-.-.Y..............--................--------...----.------prtlatgdnatakvqaalnstpnv....................................................................
A0A1F5LN85_9EURO/546-695               ..................................KHRSR.........SR.D...I....AS....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YS....QR.KDREK.-..............................SK.E..R..E..HS...........R.......Y..........DHD....pNR..........DP..Y.EES....Y......D..P....E....P..........Y.P..P.SPH..aGA..Q.AP.PMGvDPH........YY.........PN..S.N...Y.F...P........P....PPGD................STH.......---.--....NLN....T..TPAP......YHP..AD...Y..P...PP......PGAA....P...Q...P..Q..P.Y.S.Yg...........avPPg..............pGMGPETYA...PRPR.RADENV............................................................................................
A0A5N6Z5V7_9EURO/526-665               ..................................KRRSG.........SR.E...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YA....QR.RERKE.A..............................EK.E..R..E..KP...........S.......F..........DDD....aRH..........GS..Y.GES....Y......N..P....E....P..........Y.P..H.SP-...QP..-.-P.QPN.EHQ........YY.........PN..T.N...Y.F...P........P....PPGP................APR.......---.--....-ST....G..RTAP......YNP..AD...Y..P...PP......PGAV....P...P...S..P..P.Y.G.Y..............LP................PLGPEPYL...ARPR.RADENV............................................................................................
A0A0A2KDD1_PENIT/540-687               ..................................KHHSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......H..........DDN....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..tAP..G.AP.PMV.DSH........YY.........PN..N.N...Y.F...P........P....PPGD................STH.......---.-N....LNG....G..TPAP......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaPPg..............pGPGPEQYA...SRPR.RADENV............................................................................................
A0A167RTY9_9PEZI/701-763               ..................................RSRSR.........LR.N...L....AA....AG.A....G.A...A....A....A.A....I.G..I....K...K..YQ....DK.KNRDE.Rn...........................kqDR.D..R..D..YD...........R.......E..........QERd...hDR..........DR..H.RDE....Y......R..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------d...........................................................................................
A0A1Y2LKH8_EPING/366-430               ..................................RSKSR.........VR.E...V....GT....LA.A....L.A...-....G....V.G....L.A..A....Y...A..VG....KR.NKEKN.Vpvtt......................vveeHR.S..R..S..RR...........R.......R..........GSS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rhgrsrsrsvt.................................................................................
W9W1E3_9EURO/364-467                   .................................s-KRSR.........SR.S...I....AA....RG.L....A.A...L....G....L.K....D.A..A....D...K..VD....PG.RERD-.-..............................-R.R..R..N..YD...........N.......Y..........DDD.....GR..........SS..R.YGG....Y......-..-....-....G..........Y.N..D.S--...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rdvgtiqpqydyanggprslsvprgapsgyeldygprhtgdpetds..............................................
A0A0J8QS49_COCIT/156-318               ..................................RERSR.........SR.D...L....AT....AG.L...aA.A...G....A....A.G....L.A..A....H...K..YA....QR.KERKK.N..............................ER.D..R..R..RD...........E.......G..........EA-.....RQ..........DS..Y.DDT....Y......S..T....I....P..........Y.P..P.SPP...PP..S.AS.SYP.QDN........YY.........PQ..T.N...Q.FaqsPnq...ttgP....PPGH................YQY......pPSN.YP....PPG....T..ASMPppnhvsHNP..AD...Y..P...PP......PGAP....P...P...A..Q..H.Y.N.Y..............PV................PPAQDPYA...HLQP.RGDENV............................................................................................
A0A4Z1KTP7_9HELO/548-651               ..................................RSQSR.........IR.T...A....AE....IA.G...sG.L...A....G....A.A....V.-..A....G...L..YE....NR.KAKQE.A..............................EE.D..E..E..YE...........R.......R..........ERR.....RS..........RT..R.SRT....R......S..R....S....R..........A.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rstgvysdpgvdpelgmvqygtepvythqqpapfdrpneydpa.................................................
A0A6G1FTE2_9PEZI/345-413               ...............................hrhRSLSR.........GK.T...L....AA....VG.G....L.Aa.iG....A....L.A....Y.A..A....T...R..NN....NN.KTDER.R..............................SR.S..R..R..RR...........A.......S..........--V.....TE..........DE..S.PRS....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------stskhmdpeh..................................................................................
A0A1V6NZN5_PENDC/522-668               ..................................KHRSR.........SR.E...I....AE....GV.L....G.A...S....G....L.G....Y.A..A....H...K..YQ....QH.RDRKD.Gr...........................srSR.S..H..S..RT...........R.......Y..........DDD....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..V.SPH..aAP..H.QP.PPE.PN-........YY.........PN..N.N...Y.F...P........P....PPDS................TTN.......---.--....-LH....A..PPQP......YNP..AD...Y..P...PP......PGAA....P...P...P..E..P.Y.S.Y.............gAA................GPGLGQYA...PRPR.RADENV............................................................................................
A0A3M6ZE02_HORWE/347-405               .............................gnrvg-----.........-R.D...V....AG....AA.L....G.-...A....V....G.A....E.A..I....H...R..YR....SK.SRRRR.-..............................SR.S..R..S..RS...........G.......S..........FD-.....--..........RY..Y.DGP....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrrsrsqsl...................................................................................
A0A319DBM7_9EURO/302-372               ...........................rsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....NK.SNSNK.D..............................RR.S..R..S..RH...........R.......H..........AAS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------strslplnkdgersqskt..........................................................................
A0A4R8QR31_COLTR/691-813               .....................srdrgyprdrass-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....-R.DRPIN.R..............................ER.E..R..D..RR...........R.......Y..........DEA.....PR..........EG..Y.YDD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGA........Y-.........--..-.-...-.Y...P........P....PAATsa............sfTQH.......PNI.ST...tNLR....D..TYPP......-YP..QD...Y..P...TP......PMAT....G...G...A..-..-.G.G.Y..............PP................PP------...----.------pggpppaggpppttrfgp..........................................................................
A0A1C1CTM8_9EURO/536-677               .................................k-NKNR.........MQ.D...V....AS....IG.I....A.A...L....G....L.K....G.A..Y....S...E..WQ....ET.REAQR.E..............................QK.E..E..K..EK...........R.......E..........RHK....aKRaarr..rkmsMI..A.AHN....Y......V..D....G....G..........FtG..S.MPN...LA..S.YP.QQ-.--Q........YP.........PQ..P.P...T.F...P........P....PPGA................FAY.......GTS.SP....VH-....-..-YAD......DNP..YG..aI..A...QQ......PGFV....P...A...P..P..-.-.-.-..............--................-P------...----.------gpqmgvpraeth................................................................................
A0A5N6Z5V7_9EURO/380-479               ..................................RSQSR.........LR.K...A....L-....-P.I....V.A...A....G....L.G....T.A..A....A...KglYE....KH.KENKK.Dggs.......................ssrrER.S..R..S..RS...........R.......A..........PSG....iYP..........DP..T.RDS....A......G..L....I....E..........Y.G..Q.DPV...HG..R.IP.AA-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dyygrpvsqhayysdasdp.........................................................................
T0KDB4_COLGC/456-501                   ............................rsrsrs-RKSR.........SR.S...V....AK....AA.A....A.T...A....A....AaG....L.V..K....H...F..RD....KS.KSK--.-..............................SR.S..R..S..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sk..........................................................................................
A0A166MYR9_9PEZI/646-698               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KK.KEKEK.D..............................ED.R..R..S..RE...........R.......S..........ARS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrdrs......................................................................................
A0A168JB54_MUCCL/709-750               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKE-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sglegahhtsgnplhsg...........................................................................
R7YPI0_CONA1/593-724                   ..................................RSKSR.........TR.R...V....AE....AA.A....L.A...G....V....A.G....V.A..A....N...R..AS....KR.RRSKD.Rgsr........................ergSR.E..R..G..SR...........E.......R..........NDG....dRQ..........RR..M.EEG....T.....sA..S....D....N..........Y.G..T.PPP..qAG..YpIP.PYQ.GGR........YY.........PE..T.N...E.F...P........P....PPTI................ASE.......DYA.MH....PPM....N..GYPP......NPP..MN..gY..P...PP......PMS-....-...-...-..-..-.-.-.-..............--................--------...----.------ay..........................................................................................
A0A1Z5TUU8_HORWE/634-802               ..................................RSRSR.........AK.D...L....TG....AG.A....A.A...G....V....A.G....V.A..A....H...E..YG....KR.KERSR.Nre..........................aeSR.R..R..E..DE...........R.......Y..........EDR.....YRg.......dgDH..Y.EPH....Y......D..H....P....G..........Y.L..-.PP-...QA..H.AP.YDN.HQ-........AY.........PG..G.N...Y.F...P........P....PPTD................DHVy.....nQAA.PP....QQS....N..PYPA......YNP..AD...Y..A...QG.....gPQQQ....P...Y...S..H..P.Y.G.A.............yDSeanlgap..ypggnetF-------...----.------agdtryaptpehdgrr............................................................................
A0A5N7DNY0_9EURO/563-606               ..................................KHRSR.........SR.D...L....TE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKK.A..............................EQ.E..R..E..RP...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------se..........................................................................................
A0A0K8LFQ8_9EURO/522-657               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YK....QS.RDRKK.E..............................EK.E..R..S..K-...........-.......Y..........DD-.....--..........DS..Y.PSS....Y.....pS..D....L....P..........Y.P..P.SPL...PP..T.HP.VEN.QH-........-Y.........PN..S.N...Y.F...P........P....PPGS................TPA.......---.--....-PA....A..PPAP......YNP..AD...Y..P...PP......PGAV....P...P...A..Q..S.Y.G.Y..............PP................EPGPDRYA...PRPR.RADENV............................................................................................
A0A395I4D9_ASPHC/397-494               .................................rRDRSR.........SK.S...A....IR....KA.Lp..vL.A...A....G....L.G....T.A..A....V...TglYE....KN.KEKKE.G..............................SR.R..R..S..RS...........R.......S..........RAP.....-S..........EV..Y.SDP....T......K..S....S....Pgl......ieY.G..E.HPV...HG..S.IP.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------anyygrpgsshgyysdasd.........................................................................
A6RCP1_AJECN/417-528                   ......................kspgrirqgipi-----.........--.-...-....AV....AG.L....-.-...G....S....A.A....-.I..A....N...L..YE....KH.KEKKE.S..............................ES.-..S..E..RK...........E.......K..........NHR.....RRsr.....srsMA..R.SST....Y......-..P....D....P..........S.R..S.SPQlieYG..D.DP.V--.---........-Yg......siPA..N.N...Y.Y...G........R....PPSR................QSS.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------spraieasprrssrr.............................................................................
A0A1Y2V118_9PEZI/70-250                ..................................RSQSR.........LR.D...L....AA....AG.L....G.T...A....A....A.A....I.G..I....K...K..YH....DR.QKSKE.Rekeeksrdrs..........gdrsldredrDR.D..R..E..RR...........R.......Y..........EEE....iAG..........DP..Y.YD-....Y......-..D....A....G..........V.P..P.SP-...--..-.-P.HAS.GGA........YYp......ppPQ..G.QgvpY.Y...P........P....PPQApdvagp....sgpggfTQH.......PNL.ST....PNV....N..DYPPh...prYNP..QD...Y..V...NL......PPPN...lP...P...P..P..P.G.-.-..............PP................--------...----.------psgpappgagnrpgpen...........................................................................
A0A1V6TAM2_9EURO/158-218               ................................gs-----.........--.-...A....AG....AA.L....G.A...V....G....M.N....M.A..T....H...E..YK...dHK.KKHKK.D..............................KK.D..K..H..HK...........K.......H..........KHH.....KR..........SS..S.SSS....S......S..S....S....S..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sssssn......................................................................................
A0A2V1D6T8_9PLEO/437-515               ..................................RSRSR.........VR.T...G....IP....IA.A....-.A...G....V....A.G....A.A..V....T...G..LY....ER.QKAKK.Eak..........................elSR.S..R..S..RS...........R.......S..........KSV.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsarrhstasdgglveyggspiysdpvpv...............................................................
A0A443HVL7_BYSSP/558-701               ................................hs-SRSR.........SR.H...L....AE....AA.L....A.A...A....A....G.G....F.A..A....D...Q..YA....KK.KERKR.A..............................EK.E..R..R..RH...........E.......S..........DED.....-Y..........DP..Y.EDQ....Y......D..P....D....P..........Y.T..P.PPP..pAG..A.GP.YAG.DH-........HY.........PQ..T.N...S.F...P........P....PPGS................APV.......P--.--....-PQ....S..QPAP......YNP..GE...Y..P...PP......PSAA...pP...P...P..Q..P.Y.G.Y..............QP................PPGPDPYA...PRPR.RADENV............................................................................................
A0A5N5XDY5_9EURO/295-358               ...........................rsrsrsq-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..R..RS...........R.......S..........RHH.....R-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sssvrpgkta..................................................................................
H6C6Y6_EXODN/485-594                   ................................keRSRSR.........VR.Q..aL....PV....VA.A....G.L...G....S....A.A....L.A..G....-...L..YE....KN.KARKE.Akq.........................iaeEQ.R..R..A..RS...........R.......S..........RSR....aRS.........dGY..Y.DGP....R......-..D....A....A..........L.S..D.PGLi.eYG..N.GP.MYG.NN-........FG.........PD..Y.Y...G.R...P........P....PAEG................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------yygasnavvp..................................................................................
A0A232LTH9_9EURO/539-687               ......................sdrsrrhrhngg----R.........TR.E...I....AE....AS.L....V.S...G....G....L.G....Y.E..A....G...K..HV....ER.KERIT.E..............................RQ.S..K..D..RR...........N.......H..........DDR....dHDr.......glDP..Y.EEL....Y......D..P....T....P..........Y.T..P.SP-...--..-.PP.TGS.SDQ........YY.........PN..T.M...K.F...P........P....PPGS................GLA.......---.--....---....-..-NPP......-HV..AN...Y..P...PP......SRAA....P...P...P..H..S.Y.G.Y..............PPpp............vgPPGNDPYG...PPPR.RADEK-v...........................................................................................
A0A1S8B208_9PEZI/348-428               ..................................RSHSR.........GR.K...V....AG....VA.A....L.A...A....V....G.A....L.A..Y....A...A..GR....GQ.KGNPN.Tnv..........................ieRR.S..R..S..RR...........-.......R..........RHS.....VS..........GA..S.GDD....F......S..P....S....P..........S.R..S.RSK..sKH..R.DP.EHK.N--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rr..........................................................................................
A6RCP1_AJECN/562-700                   ..................................RSKSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.KERKR.A..............................EK.D..R..R..TY...........A.......H..........DHD.....YS..........DS..Y.EDG....Y......E..P....A....P..........Y.P..P.SP-...--..-.-P.SNG.PN-........YY.........AQ..G.S...Q.F...P........P....PPGA................APV.......P--.--....PPN....V..QPGP......YNP..AD...Y..P...PP......PGAA...pQ...P...P..S..N.Y.P.Y..............PP................PPGVDAYA...PRSA.RGDENV............................................................................................
B6HIZ7_PENRW/640-721                   ................................gd--RSR.........SR.E...I....SS....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YS....QQ.KVRRR.S..............................-E.E..R..E..LL...........W.......K..........KEK....kEE..........VS..R.KRS....R......S..C....S....D..........N.D..D.APR..gRT..R.TP.YNQ.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dlispav.....................................................................................
A0A7D8YMR6_9HELO/529-626               ..................................RSKSR.........IR.TgaeI....AG....AG.L...aG.A...A....V....A.G....L.Y..E....N...R..KA....KE.DEQKE.Aehv.......................srrrSR.S..R..T..RS...........R.......S..........RAR.....SV..........GY..S.DPG....V......D..P....ElgmvQ..........Y.G..T.DPV...YT..H.AP.PA-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ttyqeydrvs..................................................................................
K1WW28_MARBU/694-854                   ..................rsrsrrrrhsssssgg--RRR.........SR.S...V....AK....VA.A....G.T...A....A....A.A....I.G..M....N...Q..YQ....KR.KGRKE.A..............................DR.E..R..E..RR...........R.......Y..........EEE.....EQp.......peNY..Y.ARD....Y......-..Q....D....D..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PQ..N.N...A.F...P........P....PPQPg..............fTQHt.....tTST.TH....VTR....D..GIPP......YNP..AD...W..A...NP......PPPP....L...H...H..D..P.Y.V.Y..............SG...............hHAGENPYF...PPP-.------pvap........................................................................................
A1DGB5_NEOFI/538-673                   ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YK....QS.RDRKK.-..............................-E.D..R..E..RS...........K.......Y..........DD-.....--..........DS..Y.PSS....Y.....pS..D....L....P..........Y.P..P.SPL...PP..T.QP.GEN.P--........YY.........PN..S.N...Y.F...P........P....PPGS................TPA.......---.--....-PP....A..PAAP......YNP..AD...Y..P...PP......PGAV....P...P...A..Q..P.Y.G.Y..............PP................EPRPDRYA...PRPR.RADENV............................................................................................
A0A168JB54_MUCCL/358-432               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKE-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sglggthhtsgnplhpgsgmdnhhstsgnplqpgsgidnhhpasgnplhp..........................................
A0A0D1XL02_EXOME/427-575               ......................ghhgnamaigag-----.........--.-...-....--....-G.L....A.AgvlG....G....A.A....I.A..H....H...Q..TN....KR.RSRSS.S.............................gDS.N..S..D..LR...........R.......H..........SQG....sNR..........GY..S.RSP....H......R..L....N....G..........E.V..P.SP-...-G..H.DL.STS.SSD........TY.........VE..G.L...T.E...P........S....PPQS................IPP.......PSR.PD....NPR....R..DSDP......-DP..ST...I..P...PT......PTTR....S...R...-..R..N.S.A.Lg...........tmAP................PSAIHSYI...HRP-.------aips........................................................................................
A0A178ET40_TRIRU/565-700               .................................nRSRSRhgn...gnlAA.G...L....AA....AS.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......Y..........DRD.....YR..........DP..Y.EEE....Y......-..P....S....P..........P.G..P.PPG..pAS..Y.QP.PAA.QE-........YYgvpp.ppgpPG..G.R...G.Y...P........P....PPGP................---.......---.--....---....-..---P......--P..GP..gY..F...GG......PGP-....-...-...-..-..-.-.G.G..............PP................VYRGDENV...PQPS.RQHQN-g...........................................................................................
B8M1D8_TALSN/481-624                   ..................................RSSSR.........IR.D...F....AE....AG.L....A.A...A....G....L.G....Y.A..A....S...K..IS...gNK.KEKSH.R..............................SR.E..R..E..SR...........R.......H..........DHD.....-T..........DS..Y.EEP....Y......D..P....A....P..........Y.M..Q.PP-...PP..G.AP.VPP.TES........YY.........PY..T.N...S.F...P........P....PPGS................TPN.......---.--....---....P..PPAP......YNP..TE...Y..P...PPp....pPGAV....P...P...-..P..V.H.G.Y..............PPpp............gaPPGNEPYA...PQPR.RADENV............................................................................................
A0A4Q4WLE6_9PEZI/653-703               .............................tssha-----.........GR.D...A....AL....AG.A....G.A...G....A....A.G....Y.G..A....H...K..YA....RR.DD---.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gltnttssqheptvttgtte........................................................................
A0A1Z5TUU8_HORWE/347-404               ..............................nrvg-----.........-R.D...V....AG....AA.L....G.-...A....V....G.A....E.A..I....H...R..YR....SK.SRRRR.-..............................SR.S..R..S..RS...........G.......S..........FD-.....--..........RY..Y.DGP....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrrsrsqsl...................................................................................
A0A066XKL1_COLSU/654-716               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..L....K...Q..YQ....KK.KEKEK.D..............................ED.E..D..R..RS...........R.......E..........RSP.....RS..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrdrsisrsrays..............................................................................
A0A4Z1P1V0_9PEZI/599-748               ..................................RSRSR.........SR.A...L....AE....GI.A....T.A...G....V....V.G....V.A..A....N...E..IN....KR.RQRKR.-..............................DK.K..R..D..DS...........R.......-..........---.....-R..........RH..Y.HSD....S......-..D....S....V..........L.S..S.---...--..-.RS.DTS.T-Q........FY.........PA..S.N...Q.F...A........P....PPPNfqqpy......hpqhvI-Ng.....gGYA.EP....VYAs..gA..NI-P.....vYNP..AN...F..G...PT......NGPT...lP...P...D..D..P.Y.V.Hq...........hnL-................-PHQDPYS...YEQH.GRH---degy........................................................................................
A0A4Y8D0A2_9HELO/694-849               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YR....KR.KEKKE.Kkekk.....................daekhER.E..R..E..RR...........R.......Y..........EDE.....AP..........ES..Y.YTN....F......R..D....E....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...A.F...P........P....PPTSnpet........ftnhGNKs.....tPFV.NE....IP-....-..AIPP......YNP..QD...Y..A...SQ.....rPTTH....D...P...-..-..-.H.H.Y..............PPs.............srV-------...----.------pgdnvsthqssn................................................................................
A0A3E2GRF7_SCYLI/582-728               ..................................RSRSR.........VR.D...I....AG....AA.L....G.A...T....A....T.A....V.G..I....N...Q..YR....KR.KEKKE.Re............................aET.E..R..D..RR...........R.......Y..........EEEa...pSD..........HY..Y.AQR....H......F..D....D....G..........Y.P..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...S.F...P........P....PPVA................PGY.......PPQ.TT....PPH....V..PEPPi...paYNP..AD...Y..A...GQ......PTG-....-...-...-..H..D.S.Y.F..............PP................PRSADNVS...PSLN.RQ----spdni.......................................................................................
A0A2J6Q4H2_9HELO/30-143                ..................................RRRSR.........VR.E...D....DA....AA.I....-.S...A....A....A.A....T.G..I....Q...Q..HK....ER.QEKKK.A..............................ER.E..S..Q..RK...........R.......Y..........GEE.....-E..........SP..A.EDS....D......G..G....N....H..........R.K..D.HC-...AQ..Y.PP.RGR.RGA.......lYD.........PE..T.N...Q.L...I........K....RPTD................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dftqqptdnhlgkgdprlephltpr...................................................................
U6KG47_9EIME/184-288                   ...........................gtaevpa-----.........--.-...-....AA....AA.A....A.A...T....A....A.A....A.A..A....A...A..AQ....QH.QQQQQ.H..............................QQ.Q..Q..Q..QQ...........Q.......Q..........QQ-.....--..........DL..S.LFL....L......Q..Q....Q....Q..........Q.K..Q.TPS..lLL..Q.HP.QHP.QQ-........QH.........PQ..Q.Q...Q.H...P........Q....HPHQ................HPQ.......QQQ.QQ....QQQ....Q..Q---......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qamkst......................................................................................
A0A553HVQ4_9PEZI/648-779               ...........................rsrdrsd-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.RPRDR.R..............................SR.D..R..E..RR...........R.......Y..........EEA....aAG..........DP..Y.-SP....Y......D..V....E....A..........P.P..P.SP-...--..-.-P.YAS.GG-........-L.........PP..A.N...Q.G...P........P....PPPVgp...........ggfTHH......sNQS.TA....NLN....G..PYPP......YNP..QD...Y..A...NLpp..ppPGPP....P...A...SapA..S.G.S.Y.............fPP................-PGGPGHH...P---.------gpenvsqvpn..................................................................................
A0A425BSJ7_9PEZI/369-421               ............................htgakt-----.........--.-...-....AG....AL.G....A.A...G....A....A.G....Y.G..A....H...E..YK....KH.HDNKG.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------yagndynttgtgtgagytgndy......................................................................
A0A2J6S1J8_9HELO/531-618               ..................................RSKSR.........IR.T...G....AE....IA.A...aG.L...A....G....A.G....V.A..GlyenR...K..AK....EE.REEEE.H..............................EA.R..R..E..RR...........R.......S..........RSR.....--..........AR..S.VGT....Y......S..D....P....G..........V.D..P.ELGmvqYG..T.EP.VYT.HPG........YY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dpa.........................................................................................
A0A1V8UUF7_9PEZI/644-823               .................................r-HSSR.........SR.S...LgvsgAQ....AA.G....L.A...G....A....A.A....L.G..A....H...E..LG....KR.RERSR.S..............................RA.D..T..D..GR...........R.......R..........SDD.....YT..........DT..T.FSD....Y.....dH..P....S....G..........Y.I..A.PR-...HS..D.AG.YNR.QGGq......sSY.........PG..G.M...Q.F...P........P....PPNAaqadpayanahadpfaTNR......dSTA.AA....QNY....S..PY-P.....aYNP..AD...Y..P...PT......GTTH....P...Y...E..Q..T.R.G.Vyges.....datlgAP................YPGQDTFA...GDSR.------faaped......................................................................................
G4N0D9_MAGO7/486-540                   ..............................rtrsRSRSR.........AA.S...V....AK....AA.A...gT.A...A....V....A.G....I.V..K....H...L..RD....KS.RARSG.G.............................rSR.S..R..S..HS...........R.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sksprh......................................................................................
A0A5N6D9T0_ASPPA/304-377               .......................rsrsrsrshsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........S-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svrsgrttdgekrs..............................................................................
W6PSX9_PENRF/699-813                   ....................dstvgsgssshrgg-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.RDHRH.-..............................DR.D..R..D..RD...........R.......D..........RDR....dSR..........HH..H.HRR....S......S..S....V....P..........Y.P..P.MPP...PS..S.TA.SD-.RHN........FY.........PD..S.S...H.HrhhP........S....APKH................HEE.......RDQ.NK....APE....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------adsdstidlpsrfdgqgrplperdpa..................................................................
A0A074YSE8_AURPU/553-710               ..................................RSRSR.........TR.G...L....AE....GA.A....A.A...G....V....A.A....V.A..A....H...E..LG....KR.DERRR.S..............................DR.D..R..D..RD...........R.......D..........RRE....eEE..........DM..Y.AHD....R......-..-....-....P..........Y.S..P.PPMganAA..Y.PP.TPQ.SQD........YY.........PA..T.N...S.F...P........P....PPTD................-NY.......GRQ.PD....YPP....H..EYPP......YNP..AD...Y..P...PP......PGAAg.vpR...G...R..H..D.E.R.Y.............aSPdpn..........lgyPPANETFA...GDTR.YAGDN-r...........................................................................................
A0A136J136_9PEZI/620-688               ..................................RSKSR.........LR.E...A....AA....GI.L....G.T...G....A....A.A....I.G..I....K...K..YS....DH.QKAKE.Re...........................arS-.-..R..E..QS...........R.......D..........RSRa...rSR..........DM..S.RD-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrsrsvdarsd................................................................................
A0A0D2FDQ0_9EURO/644-803               ...............................rgg--RRH.........SR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....S...E..AE....RR.KQERR.D..............................RR.A..R..R..RQ...........Q.......E..........EGY.....GR..........DP..Y.EDN...nY......N..P...gA....Q..........Y.A..P.TPP..pPG..N.DP.YAT.QQG........FY.........PQ..S.S...Q.F...P........P....PPGS................IPQq.....yPPQ.AApgmaPPA....P..GPAP......YAQ..QG...Y..P...PPp....pPPGA....P...P...P..P..G.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsa......................................................................................
A0A179UYF2_BLAGS/340-447               ..........................rikqglpi-----.........--.-...-....AA....AG.L....-.-...G....T....A.A....I.-..A....N...L..YE....KH.KEKKE.S..............................ESsE..R..G..HR...........R.......R..........SRS.....KS..........VA..R.SST....Y......-..P....D....A..........S.R..S.APQlveYG..D.DP.IYG.S--........-I.........PA..D.N...Y.Y...R........R....PPSR................QPS.......--R.NR....RA-....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrtryrddgpg...............................................................................
A0A178AVN6_9PLEO/350-419               ..................................RSKSR.........VR.E...I....GA....LA.A....I.A...G....V....G.A....L.A..Y....A...A..GR....KN.KDKGT.Ttv.........................veeH-.-..R..H..RS...........R.......S..........RRS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rskrghsrrgrsrsvtvies........................................................................
S2JHI7_MUCC1/417-457                   ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HNRES.S..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------adghhsssgnplhp..............................................................................
A0A1B8CI28_9PEZI/320-381               ..........................hsklkmgl-----.........--.-...-....--....GA.A....A.L...G....A....V.A....I.A..A....T...K..YL...kDR.HDTKR.A..............................EE.G..R..G..RS...........R.......T..........RSP.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sragrassegrhsdpkk...........................................................................
A0A4R8QR31_COLTR/633-702               ..................................RSKSR.........LR.E...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KS.KDKEE.D..............................LR.E..R..E..RS...........R.......D..........RER.....RA..........RS..I.SRD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsisrdrgyprdras.............................................................................
A0A2H3IUL2_9EURO/478-621               ..................................RSSSR.........IR.D...F....AE....AG.L....A.A...A....G....L.G....Y.A..A....S...K..IS...gNK.KDKSR.H..............................SR.E..R..E..SR...........R.......H..........DHD.....-N..........DS..Y.EEP....Y......D..P....A....P..........Y.M..P.TP-...PP..G.AP.VPP.TES........YY.........PY..T.N...S.F...P........P....PPGS................TPN.......P--.--....---....-..PPAG......YHP..GE...Y..P...PPp....aPGAV...pP...P...M..H..-.-.G.Y..............PPpp............gaPPGNEPYA...PQPR.RADEN-i...........................................................................................
A0A0U5FQN0_9EURO/276-337               ...............................rsh-SRSR.........AR.T...F....AE....IG.L....G.A...A....A....I.A....G.A..V....A...L..AR....KK.SDKDR.R..............................SR.S..R..H..RR...........G.......V..........SSS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsvkgsedekrse...............................................................................
A0A072PTE1_9EURO/475-588               ............................rsksrnRSQSK.........VR.-...-....--....QA.Lp..vV.A...A....G....L.G....S.A..Al..aG...L..YE....KN.KAKKE.Aevv.......................qkeeRR.A..R..S..RS...........R.......S..........RAR.....TD..........AY..Y.DGP....R......-..D....A....A..........V.S..D.PGLi.eYG..N.GP.MHG.NNFg.....pdYYgr.....paPV..D.N...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ntsnavvp....................................................................................
A0A1J7I7S3_9PEZI/751-888               .............................reret-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...E..RE....RE.KERLR.H..............................RR.D..R..D..RR...........R.......Y..........EDE.....-T..........DT..T.DDG....Y......-..P....Y....D..........P.R..R.SP-...--..-.SPaHAS.GGA........YY.........PP..A.E...G.Y...Pas....srP....DPVPg..............fTAHp.....nVAT.TN....LAE....P..HYTP......YHP..PD...Y..T...AP.....pPVPG....P...P...P..N..S.A.A.T..............--................--------...----.------tngfpaapigpehvsaasrpgrpeh...................................................................
A0A5M9JNN2_MONFR/733-861               ...............................qek-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....Q...E..KR....ER.RDAEK.H..............................ER.E..R..E..RR...........R.......Y..........EDE....aSP..........ES..Y.YTN....F......R..D....D....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...Q.F...P........P....PPTSapdt........fthhGNQs.....tPFV.NT....IP-....-..PIPP......YNP..QD...Y..A...GQ.....rPVH-....-...-...D..T..H.V.H.Y..............PPv.............srT-------...----.------pgdnvstytssns...............................................................................
G7XHH0_ASPKW/557-696                   ..................................KHRSR.........SR.E...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.D..R..D..RP...........E.......S..........DED....aRR..........EP..Y.DNP....Y.....kT..P....L....P..........Y.P..A.TPA...AA..P.RP.VDD.HQ-........YY.........PN..G.N...Y.F...P........P....PPAT................GPR.......---.--....---....P..ELAP......YSP..AD...Y..P...HP......PGPV....P...P...-..Q..S.Y.E.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
B8NBW3_ASPFN/304-375                   .........................rsrsrshsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....R-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sssvrsgkttdgekrs............................................................................
A0A1V6TKK6_9EURO/587-692               ................................rsRSRSR.........LR.Q...-....AL....PV.V....G.A...G....L....A.T....V.A..A....T...G..LY...eNR.KSQKD.Gkd..........................giSR.E..H..R..SR...........S.......R..........CHA.....AS..........QF..Y.PDP....S......R..D....S....S..........G.-..-.--Li.eFG..N.GP.FTD.STPa.....ehYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gqpvspgapydvsntcgrcs........................................................................
A1CSM6_ASPCL/533-664                   ..................................KHRSR.........SR.E...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LK....QH.RDHKK.-..............................-E.E..R..E..RS...........K.......Y..........EDD.....--..........--..-.--S....F......S..E....P....P..........Y.P..P.SPL..pPA..Q.QP.AET.Q--........FY.........PN..T.N...Y.F...P........P....PPGP................TPV.......---.--....-PI....A..NNMP......YNP..AD...Y..P...PP......PGAV....P...P...A..Q..G.Y.G.Y..............PP................ESGPNRYA...PRPR.RADENV............................................................................................
W2RLM0_9EURO/515-654                   ................................rdRSRSR.........IR.T...A....AP....VV.A....-.-...A....G....L.G....S.AalA....G...L..YE....RN.KAKKE.Aev.........................iqkDE.R..R..N..RS...........R.......S..........RSR.....AR..........SE..Y.TEG....Y......R..D....G....P..........L.N..D.PGLi.eYG..D.GP.MHG.NN-........-Y.........GE..G.Y...Y.G...R........P....APQE................GYY.......---.AN....QTA....V..VPAPg....tAAP..AP...Y..G...A-......----....-...-...-..-..-.-.-.-..............--................--------...----.------trdfrdpspgygrerrsrs.........................................................................
A0A194X7G0_9HELO/505-597               ..................................RSKSR.........IR.T...G....AE....IA.G....-.A...G....L....A.G....A.A..Va.glY...E..NR....KA.KEDVR.Ee...........................veED.R..R..E..RR...........R.......S..........RSR.....ARs........vGA..Y.SDP....G.....vD..P....ElgmvQ..........Y.G..T.EPV...YT..H.TP.A--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------yqqgydydp...................................................................................
A0A1L9U746_ASPBC/554-699               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.E..R..E..RPadg.....relE.......S..........DED....aRR..........EP..Y.DSS....Y.....kN..P....L....P..........Y.P..A.TSA...AA..P.RP.IDD.HQ-........YY.........PN..S.N...Y.F...P........P....PPAA................VPR.......---.--....---....P..DQAP......YSP..AD...Y..P...PP......PGAV....P...P...-..Q..S.Y.D.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
S3CWZ7_OPHP1/493-635                   ..................................RSHSR.........IR.T...G....AE....IA.A....-.A...G....L....A.G....A.A..A....K...K..IY...dKH.QDKKE.V..............................ER.D..R..E..LN...........R.......E..........LD-.....YS..........DE..Y.EDD....R......G..H....H....S..........A.R..H.STR...SL..S.RS.QSR.---........SR.........SA..H.P...R.A...P........Y....PPST................ADA.......---.--....-DE....L..GLVE......YGS..QP..lY..A...DP......ANSN...aA...T...Y..N..R.S.S.Y..............DSa.............adAVDQDDR-...----.------hrrhrrhrsrr.................................................................................
G3XV77_ASPNA/397-504                   .............................rsrsrRRESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPG..lIE..Y.G-.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dhpvhgsippnyygrpvsphgyysdasd................................................................
A0A0D2K9Q9_9EURO/624-785               ................................dr-SRRR........hSR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....T...E..YE....KR.KQDRR.E..............................RR.A..R..K..RR...........E.......E..........EGY.....GR..........DP..Y.DDN....F......N..P....G...tQ..........Y.A..P.TPPppgPV..I.DP.YAN.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQq....ypPQA.GP....GTA...pP..GAAP......YPP..QN...Y..P...PPp...ppPPAA....P...P...A..P..T.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsae.....................................................................................
A0A2T3BE08_AMORE/628-675               ................................rsRSRSQ.........VR.N...I....AG....AA.A....A.T...G....A....A.A....M.G..V....H...E..YR....KR.RQRKE.A..............................ER.E..R..E..RR...........R.......K..........D--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------s...........................................................................................
A0A5N7BNB9_9EURO/306-381               .......................rsrsrsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssarsgrtidgekrses...........................................................................
A0A3N4L4M6_9PEZI/412-474               .................................hRRHRR.........SK.K...I....PA....AA.L....G.T...A....-....A.A....I.A..A....K...R..HH...dHR.KESRS.R..............................SR.S..R..S..RS...........R.......S..........SER.....RR..........R-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------msgpqkagymmt................................................................................
A0A319A1B2_9EURO/368-466               ..................................RDRSR.........SK.S...A....IR....KA.Lp..vL.A...A....G....L.G....T.A..A....V...TglYE....KN.KDKKE.S..............................SR.Q..R..E..RR...........R.......S..........RSR.....SR..........AP..S.E-V....Y......-..S....D....P..........T.K..S.SPGlieYG..E.HP.VHG.SIPa......nYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpgsshgyysda...............................................................................
W9Y839_9EURO/372-454                   ............................rsrsrrRSRSRsgs...pskFK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AA....KR.MNKNK.E..............................EP.R..R..S..RS...........Q.......H..........RRE.....SL..........SS..L.END....A.....sA..P....S....D..........-.-..-.---...TA..R.NP.K--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hrnk........................................................................................
A0A0U1M4K8_TALIS/257-321               .........................rhrsrsrss-SHSR.........AK.T...L....AG....IG.L....G.A...A....A....L.A....G.A..V....A...V..AR....KK.SQSNR.D..............................RR.S..R..S..RH...........R.......R..........DSP.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srvdsarsss..................................................................................
H1UXZ2_COLHI/511-639                   ..................................RSKSR.........IR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKD.R..............................EV.D..R..ElsDQ...........E.......Y..........EEE....lRR..........ER..R.ERR....R......S..R....S....R..........S.Q..A.R-S...LY..P.EP.RSA.DPElg...lveYGt.......sPL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------msgddyddaepak...............................................................................
A0A395I4D9_ASPHC/546-673               ..................................RPRSR.........SR.E...F....AE....AA.L....G.A...A....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................GR.D..R..D..RS...........-.......-..........DE-.....--..........--..-.EGP....Y......Q..H....D....P..........Y.P..P.PA-...-A..P.RP.IDD.HQ-........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....---....T..EPAP......YNP..AD...Y..P...PP......PGAV....P...P...-..Q..P.Y.A.H..............SA................RPGPEPYA...PRPR.RVEENV............................................................................................
A0A397HWZ0_9EURO/515-646               ..................................KHRSR.........SR.E...L....AE....AT.L....A.A...T....G....V.G....Y.A..A....H...K..YK....QH.REHKN.-..............................-G.E..R..D..RS...........K.......Y..........DD-.....--..........DS..Y.PSD....L......-..-....-....P..........Y.P..P.SPL...PP..T.QP.VGN.Q--........YY.........PN..T.N...Y.F...P........P....PPGT................TPA.......---.--....-PA....A..PAAP......YNP..AD...Y..P...PP......PGAV....P...P...T..Q..S.Y.G.Y..............PP................EPGPDRYA...PRPR.RADENV............................................................................................
A0A1L9STT0_9EURO/426-521               ................................rsRSHSR.........IR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..A....G...L..YE....NH.KDKKA.De...........................kaEE.Q..G..R..RS...........R.......S..........KSR.....AR..........DP..AgLIE....Y.....gD..H....P....V..........Y.G..S.IPTa.dYY..G.RP.PSD.PG-........YY.........SN..N.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------pepvsn......................................................................................
A0A161Y9K7_9PEZI/741-876               ..................................RSRSR.........DR.S...I....SR....DR.A....Y.S...R....D....R.A....Y.S..R....E...R..ST....DR.LR-NR.-..............................DR.E..R..D..RR...........G.......Y..........EDT....aRD..........DG..Y.YDD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GG-........--.........--..-.S...Y.Y...P........P....PPAAaa............gfTQH.......PNIsTA....NLR....D..QYPP......-YP..QD...Y..P...PG......PPPM....G...P...S..P..P.M.A.Tgga........ggyPP................--------...----.------pppaggpppsg.................................................................................
A0A1Y2A0R4_9PLEO/469-563               ..................................RSRSR.........IR.E...G....IP....IA.A....-.A...G....V....T.G....A.A..V....T...G.lYE....KH.KAKKE.Ake.........................lsrSR.S..R..S..RS...........R.......S..........VHSg...aRR..........HS..T.ASD....T......A..L....V....E..........Y.G..G.DP-...IY..T.DP.VA-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asshhrrsrerdyddp............................................................................
A0A0F7TW88_PENBI/493-640               ..................................KHRSR.........SR.D...L....AS....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YS....QH.RDRKK.S..............................ER.S..RsrS..RT...........R.......Y..........END....aHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..I.SPQ..aAH..Q.QP.TE-.--N........YY.........PN..S.N...Y.F...P........P....PPGS................TPN.......---.--....-LN....A..TPQP......YNP..AD...Y..P...HP......PGAA....P...P...P..Q..P.Y.N.Yga.........gnpGP................ETYPETYA...PRPR.RADENV............................................................................................
A0A168JB54_MUCCL/525-568               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKE-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sglegahhtsgnplhsgsg.........................................................................
A0A1Z5TUU8_HORWE/396-483               ................................rr--RSRsqsl.dlskAQ.K...L....GG....LA.A....V.A...G....V....A.A....L.A..G....Y...A..IK....NR.NKKNE.Tiivn......................egrpRR.S..R..S..RR...........R.......R..........ASV.....--..........DS..Y.MSP....S......D..A....G....S..........K.A..H.SPE...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hknrriaq....................................................................................
A0A2T3AHR6_9PEZI/581-654               ........................khsklktglg-----.........--.-...L....AA....AA.L....-.-...-....A....V.A....G.A..A....K...Y..YQ...sQK.IEKEE.L..............................RR.G..R..S..RN...........R.......R..........SDYs..dsED..........GY..Y.SRS....H......-..S....R....G..........P.G..P.KP-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------skggpgg.....................................................................................
A0A401L9C1_ASPAW/398-506               .............................rsrsrRRESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPG..lIE..Y.G-.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dhpvhgsippnyygrpvsphgyysdasdp...............................................................
Q0C9I2_ASPTN/392-495                   ..............................rkhsRSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KDKKE.E..............................EE.S..R..H..RG...........R.......R..........RSR....sRS..........RA..P.SDI....Y......-..P....D....P..........T.R..D.SAGlieYG..E.HP.VAG.S--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ipaadyygrpasqqgyysdasd......................................................................
A0A7D8YMR6_9HELO/425-500               .........................htklktalg-----.........--.-...L....A-....--.-....A.A...G....L....A.A....A.A..A....A...K..YV...qNR.KADKE.E.............................iGR.G..R..S..RT...........R.......S..........VSR.....RR..........SD..S.YDS....Y......D..D....D....D..........R.A..R.SRS...KH..A.DP.KHR.S--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ks..........................................................................................
A0A3A2ZU51_9EURO/400-495               ................................rpRSHSK.........IR.T...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KN.KDKKE.E..............................ES.R..R..R..GR...........R.......H..........SRS.....RS..........RA..R.SEI....Y......-..P....D....P..........T.R..D.SAG...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lieygehpvhgsipaadyygrpvsqqgyy...............................................................
A0A1J7I7S3_9PEZI/530-641               ................................ksRSRSR.........LR.T...G....AE....IV.A....-.A...G....L....V.G....A.A..G....K...K..LY...dRH.QDKKE.R..............................ER.E..R..E..LD...........S.......E..........EDE.....--..........-Y..Y.RAD....D......R..D....R....R..........H.R..S.RS-...RS..V.SR.SAA.RTT........PY.........PE..G.R...-.-...P........A....DPEL................GMV.......-EY.GA....HPL....Y..SDPP......-YP..GE...Y..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gygas.......................................................................................
A0A5M9JK00_MONFR/716-767               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..M....N...E..YR....KR.KDRKE.K..............................QE.K..Q..E..KQ...........E.......K..........QEK.....Q-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ekre........................................................................................
A0A166V6M7_9HYPO/597-735               ..................................RSKSR.........LR.D...M....AA....AG.A....-.-...-....-....A.A....I.G..I....K...E..FK....DR.HDKKD.R..............................DR.R..D..R..RS...........R.......E..........RED....vER..........MR..H.GED....L......R..R....D....Y..........F.D..D.PAGr.gSH..S.PP.TAS.GGA........YY.........PP..Y.-...-.-...P........T....TPGGpavgs.....ganfatYPD.......SHG.GA....PVH....K..EYQP......YVP..QD...Y..T...GY.....iPPAP....P...P...P..P..P.A.-.-..............--................--------...----.------gpppp.......................................................................................
A0A2H3IUL2_9EURO/254-310               .............................rsrss-SHSR.........AK.T...L....AG....IG.L....G.A...A....A....L.A....G.A..V....A...L..AR....NK.SQDDR.R..............................SR.S..R..H..RH...........R.......S..........QSR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ggdaas......................................................................................
A0A4U0V3S5_9PEZI/716-888               ................................qsRSQSR.........GP.G...M....VG....VG.A....A.A...G....A....A.A....I.A..A....H...E..IG....KR.RERSR.Q..............................RE.E..A..-..-Q...........R.......H..........DEE.....PY..........QY..G.NEP....Y......P..L....E....S..........P.T..P.QP-...GG..Y.LP.PHQ.QGAyg...neaAY.........PS..S.T...Y.F...P........P....PPTD................EYA.......-RG.EP....EP-....A..PYPQ......YNP..AD...F..A...QG......-GPQ...qP...Y...H..Q..S.Y.G.Gy............gESdat..........lgaPHPNDTFA...GDPR.Y-----gatpdatqydernrgrnpen........................................................................
M2MVN7_BAUPA/647-824                   ..................................RRRSR.........SR.H...L....AE....TG.A....A.A...G....A....A.A....V.A..A....H...E..MG....KR.RERSR.-..............................QR.D..E..Q..QR...........H.......G..........QEG.....YQ..........DQ..Y.GYG....H.....dQ..D...yP....D..........Y.H..S.AQQ..pGG..Y.LP.ADN.AQ-........QY.........PN..S.H...Y.F...P........P....PPTGe.............yaT-A......rGEP.AA....AEQ....S..PYPA......YNP..AD...Y..A...QS.....gPQPH....Q...P...Y..G..Q.L.H.Ga...........ynESdan..........lgaPYPNDTFA...GD--.------trydappaaahhergrgreppenv....................................................................
A0A2K1R052_9PEZI/393-468               ..................................RSKSR.........VR.Q...L....GG....VA.A....V.A...A....V....G.A....L.A..G....Y...A..LR....NR.NKQQQ.Im............................eRR.S..R..S..RR...........R.......R..........GS-.....--..........DS..S.VEL....I......E..Q....R....P..........A.S..A.DPK...KS..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nnriaqagl...................................................................................
A0A0S6X889_9FUNG/464-554               ..................................KSRSR.........SR.L...R....AG....VP.I....A.A...A....G....L.G....G.A..A....V...AglYE....RS.KARKE.A..............................QR.E..Q..V..TE...........R.......G..........VSV.....SP..........SR..S.RSR....S......R..S....V....P..........Y.G..E.DPN...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lrhatsdpalieyggdpiyaeqp.....................................................................
A0A7C8MR54_9PEZI/609-789               ..................................RSKST.........LR.N...V....AT....GL.G....T.A...A....A....A.A....I.G..I....K...K..YN....DH.QKNKE.Rgersserssersvg.hsrsrdrsdrardrrSR.D..R..Q..RR...........R.......Y..........EEA....aSG..........NI..Y.YPG....Y......D..V....E....A..........P.P..P.SP-...--..-.-P.HAS.GGF........PP.........PP..V.N...Q.A...P........T....PVGPg.............gfTNH......aNQS.TA....NLN....T..PYAP......YNP..QD...Y..A...NLp....pPPPG....P...P...P..A..S.A.S.Y.............fPP................-PGGPGHH...PG--.------penvsqvpni..................................................................................
A0A317V8F6_9EURO/400-501               ..................................RDRSR.........SH.S...A....LR....KA.Lp..vV.A...A....G....L.G....T.A..A....V...TglYE....KN.KEKKE.E..............................DE.T..R..R..RE...........R.......R..........RSR....sRS..........RA..A.SDI....Y......-..P....D....P..........R.R..E.SPGlieYG..D.HP.VHG.NIPa......nYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpvtphgyysdas..............................................................................
A0A084G042_PSEDA/617-801               ..................................RSRSR.........LR.E...M....AA....AA.L....G.T...G....A....A.A....M.G..F....K...E..YK....DR.KKSKS.Rdrdmps.................dreaesaDD.R..R..E..RR...........R.......R..........ERE.....RR..........RY..E.NDD....Y.....yD..D....D....G..........Y.P..P.SPR..hASggS.RP.RMS.GANsdp.ndfsTY.........PP..Q.T...Y.Y...P........V....PPDA................TATypppgppPAD.AP....VYT....S..YPPP......QEP..NA...Y..P...GP......PPP-....-...P...G..A..V.P.G.Y..............PP................PTA-----...----.------pgpapgpapgpsnrpppigpehn.....................................................................
D4AU90_ARTBC/558-692                   ..................................RSRSRhgn...gnlAA.G...L....AA....AG.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......Y..........DRD.....YR..........DP..Y.EEE....Y......-..P....S....P..........P.G..P.PPG..pAS..Y.QP.PAA.QE-........YYgvpp.psgpPG..G.R...G.Y...P........P....PPGP................---.......---.--....---....-..---P......--P..GP..gY..F...GG......PGP-....-...-...-..-..-.-.G.G..............PP................VYRGDENV...PQPS.RQHQN-g...........................................................................................
A0A0U5FQN0_9EURO/517-650               ..................................RHRSK.........SR.D...I....AG....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QH.RERER.E..............................DR.D..R..Q..RY...........-.......-..........DSD....gRP..........SP..Y.EEP....Y......S..P....G....P..........Y.A..A.SP-...--..-.NP.GGS.LDP........QF.........RN..A.N...Y.Y...P........P....PPGS................APV.......---.--....-PP....M..TPNP......YNP..AD...Y..P...PP......-NAA....P...P...-..Q..Q.Y.N.Y..............PP................-PGPDPYA...NRPR.RADENV............................................................................................
A0A0B7N6U1_9FUNG/214-285               .......................krssndndhhy-----.........KR.D...V....AL....GG.G....V.A...G....A....T.G....I.A..G....L...D..VK....KH.HDKQT.G..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ldnnhkdisshiqpdssniihsfndndhhrt.............................................................
A0A0G4LM95_9PEZI/435-530               ..............................rsrsRSKSR.........IR.Q...G....AE....VV.A....-.A...G....L....A.G....G.A..A....S...K..LW...hSR.KDKKE.A.............................kER.E..L..S..DE...........E.......Y..........EEEq...rRR..........DR..A.ARR....R.....sR..L....V....E..........Y.G..T.DPL..pPS..Q.PP.YPT.ND-........Y-.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyksassqrr..................................................................................
A0A2B7Y2U2_9EURO/280-347               .................................s-SNSR.........AK.K...L....AG....LG.L....G.A...A....A....L.A....G.A..V....A...L..AR....KH.SEKKK.Sekra......................sshdRR.S..R..S..RR...........R.......R..........GS-.....--..........SS..S.SDA....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rdpahrnk....................................................................................
A0A0G2EJI4_9EURO/389-457               ...........................rrrsrse-SHSR.........LK.Q...A....GA....VG.L....G.A...A....A....L.A....V.A..A....A...V..AR....SR.NKSVD.S..............................RR.S..R..S..RH...........R.......R..........SSV.....GP..........ET..V.DDA....R......N..P....S....H..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnk.........................................................................................
A0A093Y5R9_9PEZI/922-999               ..................................RSKSR.........IR.T...G....AE....LA.A....A.G...L....A....T.A....A.A..A....N...L..YE....RR.KAKQE.G..............................DR.S..R..S..VS...........R.......S..........LSR.....SR..........SR..S.RGG....R......G..L....D....E..........Y.E..R.P--...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------glveygaqplhsrg..............................................................................
A0A1V6NZN5_PENDC/392-484               ..................................RSHSR.........IR.Q..aL....PV....LA.A....G.L...G....A....A.G....I.TglY....E...K..NK....AE.KDGKE.P.............................vSR.D..R..R..RS...........R.......S..........HSR.....--..........AR..G.SET....Y......-..P....D....P..........T.R..D.SAGlieYG..N.DP.VEA.GH-........YY.........GQ..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------palqsgdyy...................................................................................
A0A0F0I0U5_ASPPU/306-380               .........................rsrsrshsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........SS..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------vrsgrttdgekrsesq............................................................................
A0A7C8IEV6_9PLEO/593-730               ..................................RSKSR.........TR.K...A....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AT....KR.RDRKK.A..............................EK.D..R..H..RH...........-.......-..........DDS.....--..........AY..S.TGS....Y......-..-....-....-..........-.S..P.PPT...--..T.AA.ST-.DTR........YF.........PE..S.N...Y.F...P........P....PPTA................-PV.......--E.PS....Y--....P..PYAQ......YNP..AD...Y..P...PQ......-GNL....P...P...-..-..-.T.G.Y.............tPPp.............tdP---APGN...P---.------ygryrgpdehvsapsepeh.........................................................................
A0A559LZI3_9HELO/269-339               ..........................nklktalg-----.........--.-...L....A-....--.-....A.A...G....L....A.A....A.A..A....A...K..YV...qNR.KADKE.E.............................iGR.G..R..S..RT...........R.......S..........VSR.....RR..........SD..S.YDS....Y......D..D....D....D..........R.A..R.SRS...KK..A.DP.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------kr..........................................................................................
A0A0D1Z4Z7_9EURO/364-449               ...............................rhr-SRSRsss...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKSK.De............................gDR.G..R..S..RS...........R.......S..........RSR.....RR..........KE..S.VSS....L......E..D....D....P..........D.A..P.SD-...DA..R.NP.KHR.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnt.........................................................................................
G9PCA8_HYPAI/432-520                   ...............................srsRSKST.........LR.R...G....AE....LA.A....G.A...A....A....V.G....V.A..G....K...M..WK....DH.HDKKK.-..............................ER.E..RgeS..TS...........R......gY..........SDE.....-D..........RE..Y.DGH....Ns....hS..L....I....E..........Y.G..H.DP-...LP..P.DP.RS-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ptgqgyeseae.................................................................................
A0A010Q3X1_9PEZI/517-646               ..................................RSKSR.........IR.T...G....AE....IA.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KEKKD.Re............................vDR.E..L..E..EQ...........D.......Y..........EEE....vRR..........ER..R.ERR....R......S..R....S....R..........S.Q..A.-RS...LY..S.EP.RSA.DPElg...lveYGt.......ePL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....RQR....R..RHRR......MSG..DD...Y..D...G-......----....-...-...-..-..-.-.-.-..............--................--------...----.------hepakk......................................................................................
W6PSX9_PENRF/493-646                   ..................................RHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSR-.-..............................ER.D..R..E..HS...........T.......H..........DDN....vHR..........DP..Y.EES....Y......N..P....E....P..........Y.P..L.SPQ..aAP..S.AP.PMP.DPH........YYpsnpnpnpnPN..P.N...Y.Y...P........P....PPGD................STY.......---.--....NLN....S..TPAS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaPP................GPGPEQYT...HRPR.RAEDNV............................................................................................
C8V000_EMENI/27-137                    ..............................rsrsRSKSR.........IR.K...A....LP....VV.A....A.G...L....G....S.A....V.A..A....N...I..WD....KK.KDKEA.E..............................EE.P..R..R..KD...........R.......H..........RSR....sRG..........RA..P.SDI....Y......P..D....S....T..........R.D..S.AGLi.eYG..D.HP.VHG.S--........-I.........PA..A.N...Y.Y...G........R....PPSS................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------pgyhtdasdrvardag............................................................................
A0A100ITS5_ASPNG/555-694               ..................................KHRSR.........SR.E...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.D..R..D..RP...........E.......S..........DED....aRR..........EP..Y.DNS....Y.....kT..P....L....P..........Y.P..A.TPA...AA..P.RP.VDD.HQ-........YY.........PN..G.N...Y.F...P........P....PPAT................GPR.......P--.--....---....-..EPAP......YSP..AD...Y..P...HP......PGPV....P...P...-..Q..S.Y.E.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
B5YNX8_THAPS/64-186                    .........................trnggedde-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..YE....ME.R--RR.-..............................QM.E..E..E..RY...........R.......L..........QDE....iRH..........QM..D.DDN....Y......S..D....H....H..........S.R..Q.LSR...RS..R.DP.ESD.EAS........RR.........SN..M.S...G.V...P........P....PPRS................VRS.......--G.HS....QSH....Q..SRSR......YDP..DG...M..S...HD......FGAD....D...P...-..D..G.R.H.Y..............AP................GLN-----...----.------nhggvpsvhtg.................................................................................
A0A319EH32_ASPSB/547-685               ..................................RRRSR.........SR.D...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................EK.E..R..D..RA...........E.......S..........DED....rRR..........EP..Y.DGS....Y......N..N....L....P..........Y.P..P.SPA...AA..P.QR.IDD.H-Q........YY.........PN..N.H...Y.F...P........P....PPGS................ASR.......---.--....-P-....-..DPAP......YSP..AD...Y..P...PP......PGAV....P...P...-..Q..S.Y.D.Y..............PA................RPGPDSYA...PRPR.GPDE--mv..........................................................................................
M2ZPK6_PSEFD/581-658                   ..........................khrsrsrsKSLSR.........IQ.Q...V....GG....LA.A....V.A...G....I....A.A....L.A..G....Y...A..LN....KN.KNKET.Iivn.......................dghrRR.S..R..S..RR...........R.......R..........HSV.....--..........DT..Y.ISD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------eerehrnpeh..................................................................................
A0A4Q4WVB9_9PEZI/471-558               ................................hy--RSK.........SR.G...S....AE....IA.A....-.A...G....L....T.G....A.A..A....T...K..LW...eRH.KDKKD.Rlvpvvpgveygsrp.idthdgyasptedrrHR.S..R..R..RR...........R.......-..........---.....--..........--..-.---....-......R..T....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sssssspsdsdvkk..............................................................................
A0A5N6D9T0_ASPPA/563-702               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.REGKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aRQ..........DS..Y.GEP....Y......S..P....E....P..........Y.H..H.TA-...--..L.PP.RSS.EHQ........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....-PA....G..STAP......YNP..AD...Y..P...PP......PGAV....P...P...S..Q..Q.Y.G.Y..............PP................PPGPESFV...SRPR.RADENV............................................................................................
A0A2V1C4F1_9HELO/493-586               ..................................RSKSR.........IR.T...G....AE....IA.G....-.A...G....L....A.G....A.A..V....A...G.lYE....NR.KAKED.Rdle........................veeEH.R..R..E..RR...........R.......S..........RS-.....-R..........AR..S.IGA....Y......S..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dpgvdpelgmvqygtepvythqqtttyqrgydy...........................................................
A0A1L9U746_ASPBC/303-374               ...........................rsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LR..........DT..N.EET....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqrr........................................................................................
A0A2S7QP56_9HELO/649-810               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...Q..YN....KR.RKEKK.Daek........................ekrER.E..Q..E..RR...........R.......Y..........EDE.....AS.........sPP..P.ENF....Yr....nP..N....S....T..........Y.R..D.EGF...IP..S.PP.HAS.GGS........YH.........PD..-.N...H.F...P........P....PPTNptsvp.....pgfthhGNQs.....sPYI.NE....IP-....-..PIPP......YNP..QD...Y..A...GQ.....rPTH-....-...-...D..P..L.S.G.Y..............PP................PRTGDNVS...P---.------asipsp......................................................................................
K2S5L1_MACPH/454-539                   ................................ksRSRSR.........IR.TgipV....AA....AG.L....G.-...-....G....A.A....L.AglY....E...K..NA....AK.KEDKE.E..............................RK.S..R..S..RS...........R.......S..........RSR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svpsgsrrasasdpalvvyggdpiyveptasarr..........................................................
A0A4Z1KTP7_9HELO/693-847               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YR....KR.KEKKE.Kkekk.....................naekhER.E..R..E..RR...........R.......Y..........EDE.....AP..........ES..Y.YTN....F......R..D....E....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..K.N...A.F...P........P....PPTSnpet........fthhGNKs.....tPFV.NE....IP-....-..PIPP......YNP..QD...Y..A...SQ.....rPTTH....D...P...-..-..-.H.Q.Y..............PPs..............sR-------...----.------ipgdnvsthqss................................................................................
A0A5N5M5Y0_PANHP/468-580               ......rrsrsrddlmdlergrggggrdayddsf-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..LR....EA.MERKK.Mg...........................eqQR.A..R..S..RE...........R.......L..........DSD.....--..........SE..R.SDR....Y......R..G....G....H..........G.G..P.PPL...PL..S.RP.AGN.PDQ........RR.........AN..N.T...S.F...P........P....PPSY................TED.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tdslasskksnlrkn.............................................................................
A0A1L9TGA8_9EURO/329-460               ............................rrrsrsRSKSK.........VR.Q...A....IP....VV.A....A.G...L....G....S.A....V.A..A....N...V..WD....KR.KDKKA.D..............................EE.P..R..R..KD...........R.......R..........RSR....sRG..........RP..S.SEM....Y......-..P....D....P..........D.R..D.STGlieYG..D.HP.VHG.S--........-I.........PA..A.N...Y.Y...G........R....PPSS................QGY.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsdrgrtpsrsrsrarfsssspnsseedrrrr............................................................
Q2TZD9_ASPOR/411-515                   .................................sRSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKQE.Eg...........................eaSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PT..A.D...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grptsqqayysdasdpavsd........................................................................
A0A484G7Z2_COLOR/501-563               ..................................RSKSR.........IR.T...G....AE....IA.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKE.R..............................EI.E..R..E..LS...........-.......-..........DEE....yEE..........DL..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrerrarrrsrsr...............................................................................
E3QDR6_COLGM/644-698                   ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..L....K...Q..YQ....KK.KEREE.D..............................EE.E..N..L..RS...........R.......E..........RSA.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrsrdrs....................................................................................
A0A100ITS5_ASPNG/302-372               ...........................rsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LK..........DS..H.EET....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqr.........................................................................................
A0A5N6ZL79_9EURO/412-514               ..................................RSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKKE.Eg...........................esSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PT..A.D...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grptsqqayysdasdpavs.........................................................................
A0A0D2I679_9EURO/641-794               ................................hg--RRR.........SR.D...A....AK....MA.A....A.A...G....A....G.A....I.A..A....S...E..YE....RR.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........EEG....yGR..........DP..Y.EDS....Y.....nP..P....Q....P..........Y.S..P.TPP..pPV..N.DP.YAS.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQq....ypPQT.AS....APA....P..ATAS......SYP..QQ..tY..P...PP......PAGP....P...P...A..G..A.P.T.Y..............DT...............yASGANTYA...PRG-.------penvsa......................................................................................
A0A0D2DS24_9EURO/497-604               ..................................RSRSR.........IR.Q..aL....PV....IA.A....G.L...G....S....A.A....V.A..G....-...V..YE....KH.KAKKE.Aeeive...................knrrarSR.S..R..S..RA...........R.......S..........EH-.....-S..........AY..Y.DGP....P......A..P....P....T..........N.E..Q.SLV..eYG..N.TP.MYG.NN-........-Y.........GA..D.Y...Y.G...R........P....PPQD................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyysnavvp...................................................................................
A0A1Y2VW00_9PEZI/495-570               ..................................RSHSR.........LR.T...G....AE....IA.A....-.A...G....L....T.G....A.A..A....S...K..LW...eHR.KDKKE.R..............................EH.D..R..E..LD...........D.......E..........YSD.....RD..........RS..L.SRS....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrshsrhshsrdstadre........................................................................
Q0C9I2_ASPTN/537-583                   ..................................RHRSK.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QH.KDRKK.A..............................DK.E..A..E..RS...........R.......E..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------yip.........................................................................................
A0A364L5S8_9EURO/311-353               ..................................RSKSR.........NR.H...M....AA....AG.L....-.A...G....A....A.A....A.G..L....I...E..RA....RS.KSRSR.-..............................SK.S..R..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------irqglp......................................................................................
A0A1S9DDZ8_ASPOZ/561-699               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YT....QR.RERKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aRQ..........DS..Y.GEP....Y......S..P....E....P..........Y.Q..H.TA-...--..L.PP.QSS.EHQ........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....-PA....G..STAP......YNP..AD...Y..P...PP......PVAV....P...P...S..Q..Q.Y.G.Y..............PP................-PGPESFV...SRPR.RADENV............................................................................................
A0A5M9JLR0_MONFR/761-889               ................................ek-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....Q...E..KR....ER.RDAEK.H..............................ER.E..R..E..RR...........R.......Y..........EDE....aSP..........ES..Y.YTN....F......R..D....D....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...Q.F...P........P....PPTSapdt........fthhGNQs.....tPFV.NT....IP-....-..PIPP......YNP..QD...Y..A...GQ.....rPVH-....-...-...D..T..H.V.H.Y..............PPv.............srT-------...----.------pgdnvstytssnse..............................................................................
A0A010Q3X1_9PEZI/698-843               ..................................RSRSR.........DR.S...V....TR....ER.T....Y.S...R....E....R.A....Y.S..R....E...R..ST....DD.RMRNR.-..............................ER.E..R..D..RR...........R.......Y..........EED....aRD..........DG..Y.YDN....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGS........F-.........--..-.-...-.Y...P........P....PPAAaa............gfTQH......pNIS.TA....NLR....D..QYPP......YPS..SDs.vY..P...PG......PPPM....G...P...S..P..P.M.A.Tgga........ggyPP................PP------...----.------pagghpppgggppgt.............................................................................
A0A5N6K0E4_9HELO/704-828               ................................kq-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...E..KR....EK.RDAEK.H..............................ER.E..R..E..RR...........R.......Y..........EDE....aSP..........ES..Y.YTN....F......R..D....D....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...Q.F...P........P....PPTApdt.........fthhGNQs.....tPFV.NT....IP-....-..PIPP......YNP..QD...Y..A...GQ.....rPVH-....-...-...D..T..H.V.H.Y..............PPv.............srT-------...----.------pgdnvstyksss................................................................................
A0A0F0I0U5_ASPPU/563-702               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.REGKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aRQ..........DS..Y.GEP....Y......S..P....E....P..........Y.H..H.TA-...--..L.PP.QSS.EHQ........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....-PA....G..STAP......YNP..AD...Y..P...PP......PGAV....P...P...S..Q..Q.Y.G.Y..............PP................PPGPESFV...SRPR.RADENV............................................................................................
G7XHH0_ASPKW/302-375                   .........................rsrsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LK..........DS..H.EET....R......S..Q....S....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qrr.........................................................................................
A0A139HNL3_9PEZI/658-816               ..................................RSRSR.........RR.N...L....AE....AG.A....A.A...G....V....A.A....V.A..A....H...E..IG....KR.RERSR.As............................rSR.S..R..E..RR...........R.......P..........ED-.....--..........DY..Y.EDR....R......A..D....D....P..........Y.S..P.PPM..gNS..Y.PP.YQN.QDPya....qqAY.........PG..A.N...Y.F...P........P....PPNG................ETS.......GYV.EP....QPA....Y..AHAQ......YNP..AD...Y..A...GQ......PATQ...aP...Y...D..H..Q.Q.A.Ygg..........ysEPy..............pGQSHHSYA...HDAQ.YGD---egr.........................................................................................
A0A3F3Q8Y6_9EURO/302-374               .........................rsrsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LR..........DT..H.EEK....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqr.........................................................................................
G0SEH0_CHATD/691-755                   ..................................RSGSR.........LR.D...A....AV....GA.A....A.V...G....A....A.A....I.G..L....K...K..LS...dKG.KEKEE.Rg............................rSR.S..R..E..RQ...........R.......S..........RSR....sRS..........RS..W.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srerdrere...................................................................................
U1HT54_ENDPU/646-826                   ................................rh-NRSR.........SR.D...I....AT....PA.L....A.A...I....G....G.G....I.A..A....T...E..YA....KR.KEKKK.A..............................EK.A..R..R..RY...........E.......E..........EYG.....HGhg.....qgqDP..Y.EDE....Y......D..Pv..qR....R..........Y.T..P.TPP...SS..A.DP.YGN.PNQ........YY.........RS..D.D...Q.L...P........P....PPGSapa.........plypP-Qqp...paGYQ.QQ....GP-....Y..PAQP.....sYNP..AA...Y..A...QQ......PGA-....P...P...P..I..N.P.A.Y..............PP................QNSA----...----.------ssagfppatpfasggngdprlprgrgdenv..............................................................
J3KI03_COCIM/382-492                   ..................................RSRSR.........IR.TgipI....AA....AG.L....G.S...A....A....I.A....A.A..Y....E...K..NK...aKN.EDKKE.K..............................ET.R..R..A..RS...........R.......S..........QSK.....SR..........--..-.ARS....S......S..E....S....Q..........V.G..V.PPHlieYG..D.DP.VYG.R--........-I.........PA..S.N...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------graespyhtprkhthsrsrrspstd...................................................................
A0A2T3BE08_AMORE/494-596               ..................................RSKSR.........IR.T...G....AE....IA.G....-.A...G....L....A.G....A.A..V...aG...L..YE....NR.KAKRE.Q..............................EA.E..E..E..RL...........K.......K..........ERK.....-E..........ER..R.AAR....R......R..D....R....S..........R.A..M.SPS...SY..S.DP.EVD.PE-........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lgmvqygadpvhthqtnvynpaygydpa................................................................
A0A1Y2EBN1_9PEZI/760-910               ............................eeealr-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....-K.EDRRR.Ar............................rSR.E..R..D..RR...........R.......Y..........EEE.....AAa........gGY..Y.SDE....Y......D..P....-....E..........A.P..P.SP-...--..-.-L.TAS.GGA........YY.........PP..Q.T...Y.G...P........P....PPPAgp...........agfTQQ.......SNQ.ST....MNL....N..AYPPh....nYNP..QD...Y..A...AGyp.pppPGP-....P...P...AagH..R.T.P.Y..............QP................--TSPENV...SRQA.NPGE--ndvypglndpepggadaq..........................................................................
A0A1V8SPN9_9PEZI/512-687               ..........................keakkaai-----.........--.-...I....DK....AA.G....L.A...G....A....A.A....L.G..A....H...E..LS....KR.RERSR.S..............................RA.T..K..D..GR...........R.......R..........SDD.....YT..........DT..T.YSD....Y.....dH..P....S....G..........Y.I..A.PR-...HS..D.AG.YNR.QGGq......sSY.........PG..G.M...H.F...P........P....PPNAaqadpayanahadpfaSNR......dSTA.AA....QNY....S..PYPA......YNP..AD...Y..P...AT......GTTH....P...Y...E..Q..T.R.G.Ayges.....datlgAP................YPGQDTFA...GDSR.------faaped......................................................................................
A0A395GJ13_9EURO/556-694               ..................................RHRSR.........SR.D...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................EK.E..R..D..RP...........E.......S..........DGD....rRR..........EP..Y.DGS....Y......N..N....P....P..........Y.P..P.SP-...AG..A.PP.RID.DHQ........YY.........PN..S.N...Y.F...P........P....PPGS................APR.......---.--....---....P..EPAP......YSP..AD...Y..A...PP......PGAV....P...P...-..Q..T.Y.D.Y..............PA................RPGPDTYA...PRPR.RADD--mv..........................................................................................
A0A1V6RRE2_9EURO/539-691               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..FN....ER.RKSKE.R..............................ER.E..R..E..YS...........K.......H..........DDN....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..qPP..G.PP.PMA.DPN........YY.........PN..N.N...YnY...P........P....PPGD................ST-.......---.-Y....NLN....S..TPAP......YNP..AD...Y..P...PP......PGAA....P...P...P..Q..P.Y.A.Yg...........avPPgt............apGPGPEQYA...PRPR.RADENV............................................................................................
A0A1L9R783_ASPWE/528-674               ...............................rrrKSHHR.........SR.D...L....AG....AA.L....A.A...T....G....A.G....Y.A..A....H...K..YS....QR.KDRKK.A..............................GQ.D..R..D..RP...........G.......Y..........DDDn...vSR..........DP..Y.EES....Y......N..P....E....P..........Y.P..P.SPP...AA..P.QQ.QID.DRQ........YY.........PN..T.N...Y.F...A........P....PPSS................APH.......---.--....-PA....S..NGAP......YRP..AD...Y..P...PP......PGAA....P...P...P..Q..P.Y.G.Y..............PP................PPGPDPYA...PRPR.RADENV............................................................................................
A0A168JB54_MUCCL/450-482               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKE-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sglggahh....................................................................................
A0A0D2BWC7_9EURO/364-449               ...............................rhr-SRSRsss...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKSK.De............................gDR.G..R..S..RS...........R.......S..........RSR.....RR..........KE..S.VSS....L......E..D....D....P..........D.A..P.SD-...DA..R.NP.KHR.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnt.........................................................................................
G2WRI8_VERDV/647-805                   ..................................RSRSR.........IR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...E..YK....KK.KDAEK.Eredeaarr..............arerslsrDY.S..R..D..RS...........R.......R..........RDE.....GR..........RR..Y.EEE....S......N..P....N....P.........hY.D..D.YSR...PP..S.PP.HAS.GGA........Y-.........--..-.-...-.Y...P........T....PTGS................GFS.......--Q.NQ....SVN....D..PYPP......YSP..HA...YtgF...PP......PQPG...gP...P...T..-..-.-.-.-..............--................--------...----.------asgaaggfptptpggpplsyqggp....................................................................
A0A094DD18_9PEZI/514-649               ..................................RSRSR.........AR.E...M....LG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RH...........-.......-..........YSS.....--..........DS..Y.PSS....R......R..S....A....D..........Y.S..P.SP-...--..-.-P.HAS.GGA........YY.........PN..H.P...T.Q...Q........Q....PPTH...............pYPT.......TPD.AH....PYG....A..HPDP......NAP..TA...F..P...PP......PVP-....-...P...S..G..A.Y.H.P..............PPm..............gG-------...----.------yeaqsqggpssgg...............................................................................
A0A3N4L4M6_9PEZI/358-416               ................................rh-SKHR.........GR.K...V....AG....VA.L....G.A...A....A....A.G....M.A..G....K...A..LH....DH.YYRRG.-..............................SR.S..R..S..RS...........S.......S..........SSS.....--..........SS..S.DE-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dhhrrhr.....................................................................................
A0A4U0V4Y7_9PEZI/680-839               ................................hsRSRSR.........GP.G...M....AG....VG.A....A.A...G....A....A.A....I.A..A....H...E..IG....KR.RERSR.Q..............................RE.E..V..Q..NR...........R.......N..........DEE.....PH..........QY..G.NEP....Y......P..L....D....S..........P.T..P.QPG...GY..L.PP.HQQ.GGYgn....epAY.........PS..S.S...Y.F...P........P....PPTD................EYA.......-RG.EP....EP-....A..PYPQ......YNP..AD...F..A...QG......-GPQ...qP...Y...H..Q..S.Y.G.Gy............gESdat..........lgaPHPNDTFA...GDPR.Y-----gatpd.......................................................................................
B8M1D8_TALSN/257-313                   ...........................rsrsrss-SHSR.........AK.T...L....AG....IG.L....G.A...A....A....I.A....G.A..V....A...L..AR....NK.SQDDR.R..............................SR.S..R..H..RR...........R.......S..........QSR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sgda........................................................................................
A0A0A2V7C7_BEABA/446-520               ..................................RSKSR.........LR.T...G....AK....IA.G....A.A...A....A....A.G....V.A..G....K...L..YK....NH.QEKKE.R..............................ER.S..R..S..RA...........P.......S..........DED.....--..........DR..F.YDR....R......A..R....S....H..........S.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrsmarslhsdagad............................................................................
K2S5L1_MACPH/347-423                   ..................................RSHSK.........GR.K...V....AG....VA.A....L.A...A....V....G.A....L.A..Y....A...A..GR....GQ.KANTT.Vi............................eRR.S..R..S..RR...........R.......R..........-HS.....VS..........GA..S.GDE....Y......S..P....S....P..........S.R..S.RSR..sKH..R.DP.E--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hrn.........................................................................................
A0A0A2K6U1_PENEN/544-693               ..................................KHHSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......H..........DDN....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..tAP..G.AP.PMA.DPH........YY.........PN..N.N...Y.F...P........P....PPGD................STY.......---.-N....LNG....G..TPAP......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaQPgp............gpGPGPEQYA...PRPR.RADENV............................................................................................
A0A0D2CID4_9EURO/644-804               ...............................rgg--RRH.........SR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....S...E..AE....RR.KQERR.D..............................RR.A..R..R..RQ...........Q.......E..........EGY.....GR..........DP..Y.EDN...nY......N..P...gA....Q..........Y.A..P.TPP..pPG..N.DP.YAT.QQG........FY.........PQ..S.S...Q.F...P........P....PPGS................IPQq.....yPPQ.AApgmaPPA....P..GPAP......YAQ..QG...Y..P...PPp....pPPGA....P...P...P..P..G.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsae.....................................................................................
A0A1L9MUX9_ASPTC/401-507               ..................................RRESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPG..lIE..Y.GD.H--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------pvhgsippnyygrpvsphgyysdasdpvas..............................................................
A0A136J136_9PEZI/386-450               ..............................rsksRSKSR.........SR.L...A....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YMq..sEK.VEKEE.A..............................TR.G..R..A..RR...........R.......H..........SYS.....--..........SY..S.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------smsrsrsg....................................................................................
A0A6H0XNR0_9PEZI/633-776               ..................................RSRSR.........AR.D...L....AP....AA.A....G.A...V....A....G.A....A.A..A....H...E..FS....RD.RSRSR.S..............................RV.G..R..D..RR...........-.......Y..........DD-.....--..........DR..Y.SED....Y......P..H....G....D..........Y.I..T.PP-...--..-.-P.QGG.NG-........-Y.........PN..S.N...Y.F...P........P....PPTD................DRA.......AID.QK....DYN....D..SYAP......YNP..AN...Y..S...QA......GAPR....E...P...Y..S..D.V.R.F..............AD................-QTHQTAE...ARER.QE----dremrqarehar................................................................................
A0A0L1J2N0_ASPNO/304-377               .......................rsrsrsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........S-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svrsgrttdgekrs..............................................................................
A0A1Y2X697_9PEZI/67-240                ..................................RSRSR.........LR.D...V....AA....AG.I....G.T...A....A....A.A....M.G..I....K...K..LH....DR.QKSKE.Regksrdssrdrsl...dredrdkekrkarrSR.D..R..E..RR...........R.......Y..........EEE.....AP.........dDP..Y.YDY....H......-..-....A....G..........A.P..P.SP-...--..-.-P.HAS.GGA........YY.........PP..P.P...A.A...Pep....agP....PPAG...............fTQHp....nqSTP.NV....NAY....S..PYPP......YNP..QD...Y..A...GV.....sPMNL....P...P...P..P..P.G.P.-..............-P................--------...----.------psgpphgsgnrtgpen............................................................................
A0A443HVL7_BYSSP/411-511               ...............................ger-SRSR.........--.S...K....IR....QA.Lp..vI.A...A....G....L.G....S.A..A....V...AglYE....KN.KAKKE.N..............................EE.A..R..P..RR...........-.......-..........SRS.....RS..........RS..R.SGT....Y......P..D....A....T..........R.D..S.GGLi.eYG..D.RP.VYG.N--........-I.........PE..A.D...Y.Y...G........R....PPSP................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dgyysdaiv...................................................................................
A0A1V6NZN5_PENDC/286-351               ..........................srsrsrsh-SHSR.........AK.T...L....ME....LG.L....G.A...A....Av..aA.G....V.A..A....L...R..NN....RN.KDERK.-..............................SR.S..R..T..RS...........R.......S..........R--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gralstagsekdd...............................................................................
A0A1Y2VW00_9PEZI/395-459               ................................rhRSKSR.........SR.L...A....TG....LA.I....G.A...A....A....L.A....V.A..G....G..lK..YM....--.-QNNK.I..............................EK.E..E..A..HR...........G.......R..........AP-.....RR..........RY..S.ENS....Y......S..S....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsgsrsdh....................................................................................
A0A166MYR9_9PEZI/691-854               ..................................RSRSR.........DR.S...I....SR....DR.A....H.S...R....D....R.A....Y.S..R....E...R..ST....DR.LR-NR.-..............................DR.E..R..D..RR...........R.......Y..........EDT....aRD..........DG..Y.YDD....Y......-..-....-....S..........R.P..S.SP-...--..-.-P.HAS.GG-........--.........--..-.S...Y.Y...P........P....PPAAsa............gfTQH.......PNIsTA....NLR....D..QYPP......-YP..QD...Y..P...PG......PPPM....G...P...S..P..P.M.A.Tgga........ggyPP................--------...----.------pppaggpppsggpppgtrfgpdhvsddisrsaspqdaqp.....................................................
A0A1L9U746_ASPBC/402-508               ..................................RRESR.........SH.S...A....LR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPG..lIE..Y.GD.HPV.QGSip....pnYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpvsphgyysdasdpvas.........................................................................
A0A2I2FP96_9EURO/293-350               ...............................rsh-SRSR.........AR.T...F....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....KK.STDDR.R..............................SR.S..R..H..RR...........S.......S..........ASR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------adhapedep...................................................................................
A0A1V8U041_9PEZI/19-102                ..................................RSKSR.........VR.Q...Y....GG....MA.A....V.A...A....A....G.A....L.A..G....Y...A..LM....KN.KGNKG.Etiiv.....................kegndRR.S..R..S..RR...........R.......A..........ASR.....DT.........gYL..S.GSS....F......R..S....R....S..........R.S..Q.S--...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------alnpehrnkr..................................................................................
A0A1F7ZZU3_9EURO/412-516               ..................................RSHSR.........LR.K...A....LP....VI.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKKE.Eg...........................eaSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PA..A.D...Y.Y...G........Q....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ptsqqtyysdasdpavsgt.........................................................................
A0A7H8QYA3_9EURO/497-639               ..................................RSGSR.........IR.D...F....AE....AG.L....A.A...A....G....L.G....Y.A..A....N...K..FS....GK.KDRKD.K..............................E-.H..R..R..RS...........R.......H..........DSG....rDH..........DS..Y.EEP....Y......D..P....A....P..........Y.M..P.SP-...PP..A.GP.APG.GDN........YY.........PY..T.N...S.F...P........P....PPGV................TSN.......---.--....-P-....-..GNLP......YPP..AE...Y..A...PH......PGAA....P...G...P..Q..P.Q.G.Y..............PPpp............gpPPTSEPYA...PQPR.RADENV............................................................................................
A0A319DBM7_9EURO/390-486               ..................................RDRSR.........SK.S...A....IR....KA.Lp..vL.A...A....G....L.G....T.A..A....A...TglYE....KN.KDKKE.A..............................SR.N..R..E..LR...........R.......S..........RSR.....SR..........AP..S.E-V....Y......-..S....D....P..........T.K..S.SPGlieYG..E.RP.VHG.SIPa......nYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpgsshgyys.................................................................................
A0A401L9C1_ASPAW/302-373               .........................rsrsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LR..........DT..H.EEK....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sq..........................................................................................
A0A4T0VLI6_9PEZI/669-808               ..................................RSRSR.........DR.S...I....SR....DR.A....H.S...R....D....R.A....Y.S..R....E...R..ST....ER.-PRNR.-..............................DR.E..R..D..RR...........R.......Y..........EES....vRD..........DG..Y.YDD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGS........Y-.........--..-.-...-.Y...P........P....PPAPta............gfTQH.......PNIsTA....NLR....D..QYPP......-YP..QD...Y..P...PG......PPPM....G...P...S..P..P.M.A.Tgga........ggyPP................--------...----.------pppaggpppsggppp.............................................................................
A0A178ZW35_9EURO/478-585               ................................keRSRSR.........IR.Q..aL....PV....VA.A....G.L...G....S....A.A....V.A..-....G...L..YE....KH.KAKKE.Ae...........................eiAD.E..R..R..RT...........R.......S..........RSR.....SR..........AR..S.EHA....Y......-..-....-....-..........Y.D..G.PPQ..gAV..N.DP.GLI.EYGngpmygnnFG.........PD..Y.Y...G.R...-........P....PP--................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qdgyysnavv..................................................................................
A0A3M2T023_9EURO/337-438               ................................rsRSHSK.........IR.S...A....VP....VA.A....A.G...V....G....T.A....A.A..T....G...L..YE....KH.KEKKE.-..............................ER.S..R..R..RS...........G.......Q..........RSR....sHS..........RE..R.SDV....Y......-..P....D....P..........M.R..D.SAGlieYG..D.DP.VHG.RDQ........YYs.......rP-..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asqqgyysdatgpsss............................................................................
A0A0M8P4S7_9EURO/502-653               ..................................KHRSH.........SK.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......R..........DDH....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..tAP..G.AP.PMA.DPH........YY.........PN..N.N...Y.F...P........P....PPGD................STY.......---.-N....LNS....G..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg............aAPrgp.........gpgpGLGPEQYA...PRPR.RADDNV............................................................................................
A0A084G042_PSEDA/487-604               ..................................RSRSR.........LR.T...G....AE....IA.A....A.A...V....A....G.G....A.A..G....K...L..YQ....RH.KEKKE.-..............................ER.E..R..S..RS...........R.......S..........SDS.....HY..........EP..R.HGS....R......S..R....S....R..........S.R..S.TTR..sFH..P.EP.GSA.DRElg....lvEY.........GH..D.P...L.R...P........E....PPYP................DDE.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sdraarrrrrrrnrsrntgd........................................................................
A0A0D1XL11_9PEZI/419-472               ................................rsRSRSR.........IR.QgvpI....VA....AG.L....G.S...A....A....V.A....G.L..Y....E...N..MK....AR.KEAKE.L..............................SR.S..R..S..RS...........Y.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrsr......................................................................................
A0A317X6X5_9EURO/553-685               ..................................RHRSR.........SR.D...I....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................EK.E..R..D..RP...........-.......-..........---.....--..........EP..Y.DGS....Y......N..H....L....P..........Y.A..P.SPA...A-..-.VP.QRI.DDH.......qYY.........PN..S.N...Y.F...P........P....PPGS................APR.......---.--....---....P..DPAP......YSP..AD...Y..P...PP......PGAV....P...P...-..Q..S.Y.D.Yp............aRP................GPGPDTYA...PRPR.RADE--mv..........................................................................................
S3CWZ7_OPHP1/711-838                   ................................nd-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...D..YD....HE.RHQSH.-..............................DR.H..R..R..RD...........K.......H..........HDR....dDA..........HG..Y.NGG....Y......Y..D....H....D..........D.S..R.PP-...--..S.PP.HVS.GGA........YY.........P-..-.-...-.-...P........A....PPMG...............sTDEl.....mQHP.NS....NIS....D..GYMS......YNP..HDqtnY..P...PP......PGP-....P...P...S..H..Q.G.-.-..............--................--------...----.------savdrlygefapgtapgvpsphaggaa.................................................................
A0A5N6FP34_PETAA/381-483               .................................sRSHSR.........LR.K...A....LP....IV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKKE.E..............................EE.A..S..G..RR...........A.......R..........SRS.....RS..........RA..P.PEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.R--........-I.........PT..A.D...Y.Y...G........R....PPSQ................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qafysdgsdpag................................................................................
S7ZET0_PENO1/503-650                   ..................................RRHSR.........SR.E...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YS....EH.RDRKK.Aers........................rsrSR.S..R..S..RN...........R.......Y..........DDD....aHR..........DP..Y.EES....Y......D..P....V....P..........Y.P..P.SP-...--..-.-P.STH.QHQa.....dpYY.........PN..N.N...Y.F...P........P....PPGS................TTN.......---.--....-LN....S..TPQP......YNP..AN...Y..P...PP......PGAA....P...P...S..Q..P.Y.S.Y.............gAP................PAGADPYA...ARPR.RADEN-k...........................................................................................
R8BUE6_TOGMI/691-750                   ..................................RSRSR.........LR.D...L....AT....GA.A....A.A...G....A....A.A....I.G..L....K...K..YG....ES.KEKKG.R..............................ER.E..R..E..SR...........E.......R..........DDR.....DR..........E-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rdrdrerdrd..................................................................................
C6HTC0_AJECH/453-591                   ...erssrrashsrsrtrshhyrddgsrsgssfs-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-DRGH.S..............................HK.N..R..T..YA...........-.......H..........DHD.....YS..........DS..Y.EDG....Y......E..P....A....P..........Y.P..P.SP-...--..-.-P.SNG.PN-........YY.........AQ..G.S...Q.F...P........P....PPGA................APV.......P--.--....PPN....V..QPGP......YNP..AD...Y..P...PP......PGAA...pQ...P...P..S..N.Y.P.Y..............PP................PPGVDAYA...PRSA.RGDENV............................................................................................
A0A6A6YH16_9PEZI/575-721               ..................................RSKSR.........SR.K...L....AE....TA.A....V.A...G....V....A.G....V.A..A....H...E..AA....KR.RERKK.A..............................EK.E..E..R..RR...........H.......S..........EEA.....--..........NY..S.NDS....F......S..P....P....P..........H.P..P.PP-...--..-.-P.NGQ.PDA........YF.........PQ..S.N...Y.F...P........P....PPRS................ATE......pYPP.EP....YPP....G..QYHP......YNP..AD...Y..P...PP......PGAV....P...P...Q..Q..Q.A.P.Yg...........ytPP................LQEPNPYA...QDPR.YHQ---pgdnv.......................................................................................
A0A074W448_9PEZI/322-398               ..................................RSRSR.........VR.T...L....AK....VG.T....V.A...A....V....G.A....L.A..A....Y...A..LR....NR.GNKET.Vivnn.....................evpppRR.S..R..S..RR...........R.......R..........S--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svgsappppldarsrseskhrdp.....................................................................
A0A6P8BFX7_MAGGR/692-768               ..................................RSKSR.........LR.E...M....AA....AG.A....G.A...A....A....A.A....I.G..L....K...G..VQ....KR.RDKSK.E..............................RE.E..E..E..ER...........R.......Q..........EDE.....RR..........ER..E.RDR....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------drdrhrnrsrvgfddrhmsper......................................................................
B8NBW3_ASPFN/412-514                   ..................................RSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKQE.Eg...........................eaSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PT..A.D...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grptsqqayysdasdpavs.........................................................................
A0A1B8GNS0_9PEZI/404-488               ..................................RSKSR.........IR.T...G....AE....LA.A....A.G...L....A....T.A....A.A..A....G...L..YE....RR.KAKQE.Gergvs....................rslsrSK.S..R..S..RS...........R.......G..........GRR.....--..........--..-.---....R......L..D....D....D..........Y.E..R.P--...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------glveygaqplhsrglergy.........................................................................
A0A1V1TG51_9FUNG/634-810               ..................................RSKSA.........LR.D...V....AA....AG.L....G.T...A....A....A.A....I.G..I....K...K..LS....DH.QRNKE.Rgeissersvrqs.....rsrdrsdrardrrSR.D..R..E..RR...........R.......Y..........EEA....vAG..........NS..Y.YPS....Y......D..V....E....A..........P.P..P.SP-...--..-.-P.HAS.GG-........FP.........PA.pT.N...Q.G...P........T....PVGPs.............vfTNH......pNQS.TT....NLN....N..PYPP......YNP..QD...Y..A...NLp....pPPPG....P...P...P..A..S.A.S.Y.............fPP................-PGGPGHH...PG--.------penvsqvpni..................................................................................
A0A074WG27_9PEZI/559-713               ..................................RSRSR.........TR.G...L....AE....GA.A....A.A...G....V....A.A....I.A..A....H...E..LG....KQ.NERRR.Sd............................rDR.D..R..E..RR...........R.......R..........EEE.....-D..........EM..Y.AHD....R......-..-....-....P..........Y.S..P.PPMganAA..Y.PP.TPQ.SHE........FY.........PA..T.N...S.F...P........P....PPTD................---.......-NY.GH....QAD....Y..PYQP......YNP..AD...Y..P...PP......PAAGg.atR...G...R..H..D.E.R.Y..............PSpep.........nlgyPPANETFA...GDAR.YAGD--dr..........................................................................................
W6XRN4_COCCA/587-743                   ..................................RSKSR.........AR.A...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AT....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........EDS.....--..........AY..S.TGT....Y......-..D....S....P..........Y.G..S.PT-...-T..S.TA.YTN.DSR........YF.........PE..T.N...Y.F...P........P....PPNA................---.......PAV.DP....NAH....S..PYPP......YNP..AD...Y..P...PP......PNNA...yE...P...N..H..P.S.Q.Yi............hPPhsdvhvg..npyapppPQQHDAYY...GQPR.RTDGNV............................................................................................
A0A1L9RA18_ASPWE/354-461               ................................rsRSHSR.........FR.Q...A....--....LP.V....V.A...A....G....L.G....T.A..Aa..tG...L..YE....KS.QDRKK.Ege..........................dgSR.H..R..E..RR...........R.......S..........RSR.....SR..........TP..S.-EV....Y......-..P....D....P..........S.R..D.SAGlieYG..R.DP.VHG.S--........-I.........PT..A.N...Y.Y...G........R....SPSP................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sgyysdatdpvas...............................................................................
A0A093YVZ9_9PEZI/8-61                  ...........................srsrsrsRSRSR.........AR.D...V....LG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RR...........A.......Y..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tpt.........................................................................................
A0A517LRB0_9PEZI/589-738               .................................q-SRSR.........SR.A...L....AE....GI.A....T.A...G....V....V.G....V.A..A....N...E..IN....KR.RQRKR.D.............................kHR.D..D..S..RR...........R.......H..........RHS.....DS..........DS..V.LSD....R......-..-....-....-..........-.-..-.---...--..-.-S.DTS.T-Q........FY.........PV..S.N...Q.F...A........P....PPPNfqqpy......hsqhvI-Nd.....gGYA.EP....VYA...sG..AHIP.....vYNP..AN...F..G...PT......NGPT...lP...P...D..D..P.Y.V.H.............qHN................LPHQDPYS...YDQH.VRHD--egy.........................................................................................
A0A3E2GRF7_SCYLI/440-517               ................................rsRSRSR.........VR.T...G....AA....IA.A...sG.L...T....G....A.A....V.A.gL....Y...E..AR....KA.KEENK.K..............................EE.Q..R..E..KQ..........eR.......M..........EDR.....RS..........R-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srarslgaysdrevdpelgmvqy.....................................................................
E9DDF0_COCPS/348-390                   ...............................pdh----R.........NR.R...M....AE....AG.L...aG.A...A....V....A.G....L.V..D....H...V..RS....KS.RSRKG.R..............................SR.S..R..I..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tg..........................................................................................
H1UXZ2_COLHI/641-843                   ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KR.KEKDE.D..............................RY.E..E..S..V-...........-.......-..........---.....RD..........DG..Y.YDD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGS........Y-.........--..-.-...-.Y...P........P....PPAPta............gfTQH.......PNIsTA....NLR....D..QYPP......-YP..QD...Y..P...PG......PPPM....G...P...S..P..P.M.A.-..............--................--------...----.------tggaggyxppppaggpppsggpppgtrfgpdhvsdelsrsaspqdaqpveqqaeeearkqedppslseeqleslrpvlsrrrsssdpsssra
A0A2G7FKH8_9EURO/556-603               ...............................yag-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..STAP......YNP..AD...Y..P...PP......PGAV....P...P...S..Q..Q.Y.G.Y..............PP................PPGPESFV...SRPR.RADENV............................................................................................
A0A3F3Q8Y6_9EURO/557-696               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.D..R..D..RP...........E.......S..........DED....aRR..........EP..Y.DSS....Y.....kN..P....L....P..........Y.P..A.TPA...AA..P.RP.IDD.HQ-........YY.........PN..G.N...Y.F...P........P....PPAT................GPR.......P--.--....---....-..EPAP......YSP..AD...Y..P...HP......PGPV....P...P...-..Q..S.Y.D.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
A0A0A1TGS9_9HYPO/445-522               ..................................RSKSK.........LR.R...G....AE....IA.G....A.A...A....A....A.G....I.A..G....K...M..WK....NH.QEKKE.R..............................SR.S..Q..S..RA...........A.......S..........RDV....dDR..........DH..YgRRD....Y......S..R....S....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrsrsiarshqsdrda...........................................................................
A0A7C8IEV6_9PLEO/473-549               ..................................RSRSR.........VR.P...G....AP....IA.A....-.A...G....V....A.G....A.A..V....A...G.lYE....KT.KAKKE.A.............................kEM.S..R..S..RS...........R.......S..........KSR.....TR..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svpsgsrrrsttsdtalveyggepiyt.................................................................
A0A0D2CBM0_9EURO/653-807               ................................ys-RRRS.........SR.D...A....AK....MA.A....A.A...G....A....G.A....V.A..A....S...E..YD....RR.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........ENY.....GH..........DP..Y.EDN....Y.....nP..A....Q....Q..........Y.P..P.TPP..pPV..N.DP.YAS.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQ.......QQY.PP....QTS....T..PGPT.....aGNP..YGq.aY..P...PP......PPGP....P...P...N..T..T.VpT.Y..............ET...............yATGANPYA...PRG-.------penvsav.....................................................................................
A0A1Z5TUU8_HORWE/508-605               ..................................RSKSR.........IR.Q...G....AP....IA.A...aG.L...G....G....A.A....L.A..Gl..yE...K..NK....AN.QESKK.Aai.........................iedEK.G..R..G..RR...........R.......R..........SRS.....RS..........RS..V.PAP....Yp....aS..E....R....S..........V.N..E.PPMi.aYG..H.DP.I--.---........-Y.........PE..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sargyysdeep.................................................................................
N1PM89_DOTSN/650-820                   .................................rRSRSR.........GK.E...F....AT....AG.V....A.A...A....A....G.A....A.A..A....H...Q..YG....KS.RERSR.S.............................rAA.S..R..E..RG...........H.......N..........DRR.....GS..........GY..Y.DDG....Y......G..N....E....P..........Y.S..P.PPD..dHY..I.QG.NQQ.NAGyg...qqqSY.........PS..S.N...Y.F...P........P....PPTG................DQAy....geHAY.AQ....QPQ....Q..SYPA......YNP..AD...Y..A...NQ......PPQQ...hP...Y...E..N..T.RgA.Ygdsd......anlgQ-................PYPGETYA...GDAR.------ygtpdhnrg...................................................................................
A0A3D8SX48_9EURO/295-355               ...............................rsh-SRSR.........AR.T...F....AE....IG.L....G.A...A....AiagaV.A....L.A..R....K...K..SN....SG.RSRSR.S..............................RR.S..R..S..VK...........G.......D..........DAK.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsqshrrk....................................................................................
A0A319EH32_ASPSB/301-366               .........................rsrsrsrsh-SHSR.........VR.T...L....AE....LG.L....G.A...A....AiagaV.A....L.A..R....S...K..SN....ST.KDRR-.-..............................SR.S..R..H..RR...........A.......S..........S--.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srrsvrgtdee.................................................................................
A0A168JB54_MUCCL/840-902               ..............................hykr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKES.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------glegahhtsgnplhpgsdnanrsvdgnndhhykrd.........................................................
A0A178AVN6_9PLEO/458-640               ................................rsRSHSR.........IR.EgvpI....AA....AG.V....A.G...A....A....G.A....V.A..V....TvevE..VE...vKI.KQLTR.Qpna........................eiaKR.R..K..R..SA...........R.......N..........DHT.....ESspg...dedsAY..S.TGS....Y......-..-....S....P..........Y.D..S.PRP...ST..A.HP.NDS.Q--........YF.........PQ..S.T...Y.F...P........P....PPTV................PVN.......EPV.H-....-HN....A..PYPP......YNP..AD...Y..P...PP......PSTV...fE...P...N..H..P.S.G.Yv...........haPPppsddln.hgnpyarpSANNQPYY...GQPR.HPGDNV............................................................................................
A0A161Y9K7_9PEZI/566-695               ..................................RSKSR.........IR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKD.R..............................EV.D..R..E..LSd.........hE.......Y..........EEE....aRR..........ER..R.ERR....R......-..S....R....S..........R.S..Q.ARS...VY..S.EP.RSA.DPElg...lveYGt.......sPL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......MSG..DD...Y..D...DP.....eP---....-...-...-..-..-.-.-.-..............--................--------...----.------akk.........................................................................................
C8V000_EMENI/175-307                   ..................................RHRSR.........SR.D...L....AG....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QH.RKE--.-..............................DK.E..R..D..RQ...........R.......Y..........DSD.....GP..........SL..F.EQP....F......S..P....G....P..........Y.P..P.SP-...-G..T.GP.VDS.SQ-........YR.........PN..-.N...Y.Y...P........P....PPGP................APA.......---.--....-PA....P..GPAH......YNP..AD...Y..P...PP......PNAV....P...P...-..Q..Q.Y.S.Y..............PP................-PAADAYA...PRPR.RADENV............................................................................................
A0A420YNZ3_9PEZI/515-557               ..................................RKRSR.........SR.S...V....AK....AA.L....G.T...A....A....A.A....A.L..V....Q...H..LR....HK.SQARN.G..............................SK.S..R..S..RS...........R.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------............................................................................................
A0A1W2TCT9_ROSNE/488-564               ..............................rsksRSQSR.........IK.T...G....AK....IA.A....A.G...L....A....G.A....T.A..T....K...L..WE....HR.QDKKH.-..............................-R.E..N..H..ER...........S.......D..........DEY.....SR..........DR..S.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------isrsqsrsrslgrhhhprdttad.....................................................................
A0A5J5EQA4_9PEZI/339-391               ...............................hks---HR.........GR.N...L....AA....AA.A....G.A...T....A....V.G....L.A..A....K...A..IH....DH.RARSR.S..............................-R.S..S..S..AS...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gsdrghrhnavl................................................................................
A0A1V8U041_9PEZI/258-435               .................................s-SRSR.........SR.G...Vs..gAQ....AA.G....L.A...G....A....A.A....L.G..A....H...E..LG....KR.RERSR.S..............................RA.D..T..D..GR...........R.......R..........SND.....YT..........DT..T.FSD....Y.....dH..P....S....G..........Y.I..A.PR-...HS..D.AG.YNR.QGGq......sSY.........PG..G.M...H.F...P........P....PPNAaqadpayanahadpfaTNR......dSTA.AA....QNY....S..PY-P.....aYNP..AD...Y..P...PT......GTTH....P...Y...E..Q..T.R.G.Vyges.....datlgAP................YPGQDTFA...GDSR.------faaped......................................................................................
A0A1F7ZZU3_9EURO/304-375               .........................rsrsrsrsh-SHSR.........VK.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...sKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........S-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svrsgrttdgekrs..............................................................................
A0A2N6NHF3_BEABA/446-518               ..................................RSKSR.........LR.T...G....AK....IA.G....A.A...A....A....A.G....V.A..G....K...L..YK....NH.QEKKE.R..............................ER.S..R..S..RA...........P.......S..........DED.....--..........DR..F.YDR....R......A..R....S....H..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrsmarslhsdag.............................................................................
A0A229X8A5_9EURO/272-336               .........................rsrsrsrsh-SHSR.........AK.T...L....AE....IG.L....G.A...A....A....I.A....G.A..V....A...L..AR....KK.SNSDR.R..............................SR.S..R..H..RR...........S.......S..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------safqpgkdaesek...............................................................................
W3XH82_PESFW/247-324                   .............................agsht-----.........AR.D...G....AG....MA.T....A.G...A....V....A.A....Y.A..A....H...H..HN....QH.DSRSS.T..............................SK.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ptgsgidptdsdpragqtsidrngsrqchqnerddssalhh...................................................
A0A364L5S8_9EURO/256-309               ...............................rss-SHSR.........AK.T...L....AG....IG.L....G.A...A....A....L.A....G.A..V....A...L..AR....NK.SQDDR.R..............................SR.S..R..H..RQ...........R.......S..........QS-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rggnaa......................................................................................
E9E4W9_METAQ/460-561                   ..................................RSKSR.........LR.R...V....AE....IG.G....V.A...A....A....A.G....V.A..N....K...L..WQ....SH.KEKKE.Hardps....................assddE-.-..-..Y..YR...........R.......R..........DSR....sR-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hrslsgsrhrsrsrsmarspysqpgadpelglveygndplypesrd..............................................
A0A2I0SMB1_9ACTN/4-73                  ................................ll-----.........-R.G...V....AR....TA.V....V.A...G....T....A.T....A.V..S....N...R..VS....RR.QQGRW.A..............................QQ.E..A..Q..QQ...........-.......Y..........QQ-.....--..........QY..Q.QQQ....Y......Q..E....Q....Q..........P.P..P.PPA...A-..-.-P.A--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------demtskidq...................................................................................
A0A1J9SBG8_9PEZI/594-754               ..................................RSRSR.........SR.A...V....AE....AA.A....L.A...G....V....A.G....V.A..A....H...E..AA....KR.RERKK.A..............................DK.K..E..R..KR...........N.......E..........EER.....--..........PF..S.EEA....Y......S..P....P....P..........P.G..A.YPA...EP..Y.PP.GAY.PPEn.....grYF.........PE..S.N...Q.F...P........P....PPQG................YDPam...qqGPY.EP....APF....G..GPAA......YNP..AD...Y..G...PN......PGPTq..aP...Y..pH..Q..Q.A.P.Y.............fPPp.............prEPQPEYYE...DRGH.PRG---ddnv........................................................................................
A0A229X8A5_9EURO/515-648               ..................................KHRSR.........SR.E...V....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YK....QN.RDRKR.-..............................-E.E..R..E..RS...........K.......Y..........DD-.....--..........DS..Y.PSS....S......-..D....P....P..........Y.P..P.SPL...P-..-.-P.TQH.VEN.......qYY.........PN..S.N...Y.F...P........P....PPGS................TPA.......---.--....-PP....A..PAAP......YNP..AD...Y..P...PP......PGAV....P...P...T..Q..S.Y.G.Y..............PP................EPGPDRYA...PRPR.RADENV............................................................................................
F9XE98_ZYMTI/399-476                   ................................rsRSRSRsf.....nrTQ.K...L....GG....LA.A....V.A...A....V....A.A....L.G..A....Y...A..LK....NR.NNKET.Vivk.......................eqppRR.S..R..S..RR...........R.......R..........SS-.....--..........--..Y.DS-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------apssvrpgsehrspdh............................................................................
A0A0D2CBM0_9EURO/501-610               ................................reRSKSR.........VR.Q..aL....PV....VA.A....G.L...G....S....A.A....L.A..G....-...L..YE....KN.KAKKE.Aeqi.......................vkdeRR.A..R..S..RS...........R.......S..........RAR.....SD..........AY..Y.DGP....R......E..G....A....I..........S.D..P.GLI..eYG..A.GP.MYG.NN-........YG.........PD..Y.Y...G.R...P........P....PPEG................Y--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ygasnavvp...................................................................................
A0A0U1M4K8_TALIS/488-632               ................................reRSGSR.........IR.D...F....AE....AG.L....A.A...A....G....L.G....Y.A..A....N...K..IS....GK.KDRKD.K..............................EH.R..R..R..SR...........H.......G..........NDR.....EH..........DS..Y.EEP....Y......D..P....A....P..........Y.M..P.SP-...PP..A.GP.APG.GDN........YY.........PY..T.N...S.F...P........P....PPGA................TSN.......---.--....-P-....-..GSMP......YPP..TE...Y..A...PP......PGAG....P...V...P..Q..P.Q.G.Y..............PPpp............gpPPTSEPYA...PQPR.RADENV............................................................................................
A0A0L1J2N0_ASPNO/527-588               ..................................KHRSR.........SR.D...L....TE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....tRQ..........DS..Y.GEP....F......S..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lnhi........................................................................................
A0A6H0XNR0_9PEZI/413-491               ..............................rsrsKSKSR.........AQ.K...L....GG....LA.A....I.A...A....V....G.A....L.A..G....Y...A..IK....KS.GEKNK.Etviin....................ehggrHR.S..R..S..RR...........R.......H..........SSV.....GS..........RY..T.EDD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------skhtdagqrn..................................................................................
A0A0D2DS24_9EURO/644-801               ...............................rgg--RRH.........SR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....S...E..AE....RR.KQERR.D..............................RR.A..R..R..RQ...........Q.......E..........EGY.....GR..........DP..Y.EDN...nY......N..P...gA....Q..........Y.A..P.TPP..pPG..N.DP.YAT.QQG........FY.........PQ..S.S...Q.F...P........P....PPGS................IPQq.....yPPQ.AApgmaPPA....P..GPAP......YAQ..QG...Y..P...PPp....pPPGA....P...P...P..P..G.Q.P.Y..............DA...............yASGANPYA...PRG-.------penv........................................................................................
A0A3D8Q8W0_9HELO/489-582               ..................................RSKSR.........IR.T...G....AE....IA.A...sG.L...A....G....A.A....V.A.gL....Y...E..NR....KA.KEERE.Eq...........................liQE.K..R..E..RR...........R.......S..........RSRa...tSV..........GA..Y.SDP....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gvdpelgmveyggtpvytqqtttyrehydpai............................................................
C4JEK8_UNCRE/306-416                   ..................................RSRSR.........IR.TgipI....AA....AG.L....-.-...G....S....A.A....I.A..A....-...M..YE....KT.KAKKE.E..............................NK.E..K..E..AR...........R.......A..........RSR....sRS..........KS..R.ARS....Y......P..D....A....P..........A.G..V.PTHlieYG..E.DP.VYG.R--........-I.........PA..S.D...Y.Y...G........R....P---................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------esphyvarrhsrssrsrrrsps......................................................................
A0A5N7DNY0_9EURO/304-379               .......................rsrsrsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssvgsgrttdgekrses...........................................................................
A0A0S7DWY3_9EURO/522-657               ..................................KHRSR.........SR.E...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YK....QS.RDRKK.-..............................-E.E..R..E..RS...........K.......Y..........DD-.....--..........DS..Y.PSS....Y.....pS..D....L....P..........Y.P..P.SPL...PP..T.QP.GEN.P--........YY.........PN..S.N...Y.F...P........P....PPGS................TPA.......---.--....-PA....A..PAAP......YNP..AD...Y..P...PP......PGAV....P...P...A..Q..S.Y.G.Y..............PP................EPGPDRYA...PRPR.RADENV............................................................................................
A0A0D2DIH2_9EURO/629-789               ................................dr-SRRR........hSR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....T...E..YE....KR.KQERR.E..............................RR.A..R..K..RR...........-.......E..........EDG....yGR..........DP..Y.EDN....Y......N..P...gA....Q..........Y.A..P.TPPppgPV..N.DP.YAS.QQG........FY.........PQ..S.S...Q.F...P........P....PPGA................VPQp....ypPQA.GP....GTA....P..---Pg...aaPYP..AQ..aY..P...PPp....pPPGA....P...P...A..P..A.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsae.....................................................................................
A0A1V6QNL3_9EURO/540-689               ..................................KHRSR.........SR.D...I....AS....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YS....QR.KDRSK.-..............................SK.E..R..E..HS...........R.......Y..........DHD....sNR..........DP..Y.EES....Y......D..P....E....P..........Y.P..P.SPH..nGA..Q.GP.PMG.VDP.......hYY.........PN..S.T...Y.F...P........P....PPGD................STH.......---.--....NLN....T..TPAP......YNP..AD...Y..P...PP......PGAA....P...Q...P..Q..P.Y.G.Yg...........avPPg..............pGMGPESYA...PRPR.RADENV............................................................................................
C1GDB7_PARBD/522-661                   ..................................RSRSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKK.A..............................EK.G..R..R..KY...........A.......R..........DHD.....YT..........DS..Y.EEG....Y......D..P....V....P..........H.V..P.SP-...--..-.-P.PNG.AN-........YY.........PH..S.N...H.F...P........P....PPGS................TPV.......P--.--....-PN....H..QGGP......YNP..AD...Y..P...PS......PGAP...pM...T...Q..A..N.Y.S.Yp............pPP................PPAADPYS...PRSI.NGEENV............................................................................................
A0A2J6S1J8_9HELO/273-333               .......................rrsdedfaltg-----.........--.-...A....AL....TG.A....A.A...V....A....G.P....L.A..V....A...A..YR....ER.REDRR.D..............................DR.-..R..E..IH...........P.......R..........DSV.....SD..........RS..Y.SD-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dedvv.......................................................................................
C5G976_AJEDR/468-605                   ..................................RSRSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKK.A..............................EK.E..R..R..TY...........P.......H..........DHD.....YL..........QS..F.EEE....Y......E..P....S....T..........Y.V..A.SP-...--..-.-P.LNS.P--........YY.........PQ..E.N...R.F...P........L....PPGS................TPI.......PP-.-P....PPN....V..QPGP......YNP..AD...Y..P...PP......PAAA....Q...P...P..P..N.H.P.Y..............PP................PPGGDSSA...PRT-.RADEN-k...........................................................................................
A0A370TQE2_9HELO/460-505               ..................................RSKSR.........AA.S...I....AK....AG.A....A.T...A...aV....A.G....V.V..E....H...I..RS....RS.RKRK-.G..............................SR.S..K..S..RI...........R.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tga.........................................................................................
A0A166V6M7_9HYPO/454-553               ..................................RSKSR.........LR.R...V....AE....IG.G....V.A...A....A....A.G....V.A..S....K...L..WS....NS.KEKKE.Earrdl....................svssaD-.-..-..-..--...........-.......-..........-D-.....--..........DY..H.RRR....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrlgsvsgtrhrsrsrsmarapysqpgadpelglveygndplyp..............................................
A0A163HMV4_DIDRA/593-755               ..................................RSKSR.........AR.S...V....AE....TA.A....V.A...S....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..R..D..RR...........H.......E..........DES.....--..........AY..S.QGS....YspggryS..P....G....Q..........Y.S..A.---...GQ..Y.SP.GQS.TARpn...dshYF.........PE..T.N...Y.F...P........P....PPTA................-PV......gHVD.GN....LPN....A..PYPP......YNP..AD...Y..P...PQ......NGHG....P...P...P..P..G.G.G.Yvh.........edmNPgn............pyARQDQNHY...HQAR.RGDENV............................................................................................
A0A2J6S1J8_9HELO/658-792               ..................................RSRSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..Y....E...E..--....--.-----.-..............................--.-..-..E..DS...........P.......-..........---.....AE..........HY..Y.DHN....Y......R..D....E....E..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PQ..N.N...Q.F...P........P....PPTGqft.........qqpfTQQp....mnTQV.HP....EGA....A..PIPP......YNP..AD...Y..A...GQ......PAAT....-...-...Q..N..P.Y.P.Y..............PE................GTGD----...----.------nltqhgnrtkltrsea............................................................................
F7W3Z0_SORMK/764-824                   ..................................RSKSR.........LG.R...L....AA....GA.A....A.A...G....A....A.A....I.G..I....K...K..LG....DN.KDKKD.N.............................kEK.E..R..E..RE...........R.......E..........REK.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ggdkeiereerdi...............................................................................
A0A0D2K9Q9_9EURO/477-584               ................................keRSRSR.........IR.Q..aL....PV....VA.A....G.L...G....S....A.A....V.A..-....G...L..YE....KH.KAKKE.Aeg.........................iadER.R..R..A..RS...........R.......S..........RSRa...rSE..........NP..Y.YDQ....G......Q..G....A....I..........N.D..P.GLI..eYG..N.AP.MYG.NN-........YG.........PD..Y.Y...G.R...P........P....PQD-................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyysnavvp...................................................................................
A0A3N4L4M6_9PEZI/199-262               ..............................rgte-HSHR.........AR.H...L....AE....SG.L....A.A...A....G....L.K....H.A..V....N...-..--....HH.RQRSH.-..............................SR.S..H..S..RG...........R.......R..........GSE.....NA..........IY..S.GEE....H......H..P....G....W..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------yddnh.......................................................................................
A0A2G7FKH8_9EURO/504-560               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.REGKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aRQ..........DS..Y.A--....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gst.........................................................................................
A0A4U6XQ92_9PEZI/687-829               ..................................RSRSR.........DR.S...I....SR....DR.A....H.S...R....D....R.A....Y.S..R....E...R..ST....ER.-PRNR.-..............................DR.E..R..D..RR...........R.......Y..........EES....vRD..........DG..Y.YDD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGS........Y-.........--..-.-...-.Y...P........P....PPAPaa............gfTQH.......PNIsTA....NLR....D..QYPP......-YP..QD...Y..P...PG......PPPM....G...P...S..P..P.M.A.Tgga........ggyPP................--------...----.------pppasgplppsggpppgt..........................................................................
R0K5Y5_SETT2/335-402                   ................................rhRSRSR.........AK.E...I....GT....LA.A....I.A...G....V....G.A....L.A..Y....A...A..GQ...rNK.KVNKE.Etvt........................iieDR.H..R..S..RS...........R.......H..........GRS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hhtrgrrrsrsv................................................................................
A0A6A6YH16_9PEZI/353-423               ................................rhRSSSR.........NK.K...L....GT....VA.A....I.A...A....V....G.Al..aY.A..A....S...R..NN....KN.KTVIE.D..............................RR.S..R..S..RR...........R.......R..........SSV.....-S..........VV..S.DT-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------erdrssskhrdpeh..............................................................................
A0A319EH32_ASPSB/402-504               ..................................RHESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKD.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEA....Y......S..-....D....P..........T.R..D.SPGlieYG..D.HP.VHG.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sipanyygrpmsshgyysdase......................................................................
Q2TZD9_ASPOR/304-373                   .........................rsrsrshsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....R-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sssvrsgkttdgek..............................................................................
A0A3M6ZE02_HORWE/397-485               ................................rr--RSRsqsl.dlskAQ.K...L....GG....LA.A....V.A...G....V....A.A....L.A..G....Y...A..IK....NR.NKKNE.Tiivn......................egrpRR.S..R..S..RR...........R.......R..........ASV.....--..........DS..Y.MSP....S......E..E....G....S..........K.A..H.SPE...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hknrriaqa...................................................................................
A0A423VTZ9_9PEZI/527-571               ..................................RSRSR.........GS.G...I....AK....AA.A...gS.A...A....V....A.G....I.V..H....H...L..RS....KS.KKRD-.G..............................SK.S..R..S..RS...........Q.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sr..........................................................................................
A0A425BSJ7_9PEZI/573-718               ............................hhtgak-----.........--.-...T....AG....AV.G....A.A...G....T....A.G....Y.V..A....H...E..YG....KR.NNDKT.Gyagn.....................tygtgNQ.N..T..A..GG...........Y.......A..........GDY.....AT..........GQ..D.GTG....Y......A..S....S....D..........Y.S..A.APN..qTG..Y.AG.NDS.GAG........YT.........PY..R.S...T.N...A........Q....GPQT................TGV......tGGN.AS....ELD....S..SQTH......TMP..GS...Y..Y...TT......PHVN....-...-...-..-..-.-.-.-..............--................--------...----.------hdvdpmnavvdmepgnr...........................................................................
A0A5M9JNN2_MONFR/689-740               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..M....N...E..YR....KR.KDRKE.K..............................QE.K..Q..E..KQ...........E.......K..........QEK.....Q-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ekre........................................................................................
M3CFH9_SPHMS/662-825                   ................................srRSRSR.........-R.G...L....AS....AG.Al..gA.A...G....V....G.A....V.A..A....H...E..WS....KR.RERSR.-..............................SR.S..R..S..RS...........R.......H..........GDR.....RRd........dDD..Y.YDD....R......R..D....D....H..........Y.G..A.PPM...NS..S.DP.YNN.NPYqq...ggqQY.........PS..S.N...Y.F...P........P....PPNAd.............ytQPR.......GNI.EP....QPE....Y..AHAHa....pYNP..AE...Y..A...NQ......PATQ...qP...Y...D..P..Q.Y.GgY.............gEP................-YPSDPYA...GDQR.YPHD--ph..........................................................................................
A0A317V8F6_9EURO/551-689               ..................................RHRSR.........SR.G...I....AE....AA.L....A.A...G....G....V.G....Y.A..A....H...K..LS....QH.NERKK.A..............................ER.D..K..D..RP...........E.......S..........DDD....gHR..........GP..Y.DGS....Y......N..N....P....P..........Y.A..P.SPA...TA..P.RP.IDD.HQ-........YY.........PN..N.N...Y.F...P........P....PPGS................APG.......P--.--....---....-..EPAS......YSP..AD...Y..P...PP......PGAV....P...P...-..Q..S.Y.D.Y..............AA................RPGPDTYA...PRPR.RADENV............................................................................................
T0KDB4_COLGC/499-614                   ..................................RSKSR.........LR.T...G....AE....IA.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKE.R..............................EI.E..R..E..LSd.........eE.......Y..........EED....lRR..........ER..R.RSR....R......R..S....R....S..........R.S..Q.ARS...LY..S.EP.RNA.DTElg....lvEYg......taPL..P.S...E.P...P........Y....PPDD................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyesaanerrrrrhr.............................................................................
B8M1D8_TALSN/314-354                   ..................................RSKSR.........NR.H...I....AA....AG.L....-.A...G....A....A.A....A.G..I....I...E..KV....RS.RSRPR.-..............................SK.S..R..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------irqg........................................................................................
A0A1Y2VW00_9PEZI/310-396               ..................rerssssdhhkrrhla-----.........EG.A...L....AG....AG.L....T.A...L....L....A.G....R.G..G....K...E..SD....HH.RDHRG.Rkvlag...................aalgalGT.E..A..V..RR...........-.......A..........KSA.....YE..........DR..Y.DDD....Y......E..D....D....D..........Y.Y..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rhrh........................................................................................
A0A4Z0YIZ2_9PEZI/405-477               ..............................rsrsRSKSR.........SR.L...A....TG....LA.I....G.A...A....A....L.A....V.A..G...gL...K..YM....QN.NKIEK.E..............................ES.H..R..G..RR...........R.......R..........RHS.....ND..........DY..S.LS-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsssrrghtrsksn..............................................................................
A0A6P8BFX7_MAGGR/539-647               ................................rrRSRSR.........LR.T...G....AE....IV.A....-.A...G....L....A.G....G.A..A....K...K.iYD....KH.QEKKE.R..............................ER.S..R..S..VA...........A.......G..........NRR.....--..........SR..S.R--....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------slssdwsydrdrrrrsrshsrsnararlpplphndssradselgmveygnnpvape....................................
A0A2V5HPZ2_ASPV1/402-502               ..................................RDRSR.........SK.S...A....IR....KA.Lp..vL.A...A....G....L.G....T.A..A....A...TglYE....KN.KDKKE.A..............................SR.N..R..E..LR...........R.......S..........RSR.....SR..........AP..S.E-V....Y......-..S....D....P..........T.K..S.SPGlieYG..E.RP.VHG.SIPa......nYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpgsshgyysdasd.............................................................................
A0A1V6T2E2_9EURO/552-703               ..................................KHRSR.........SR.E...I....AS....AA.L....G.A...T....G....L.G....Y.A..A....H...R..FN....QH.RKKSD.Kdgrs.....................rsrsrSR.S..R..S..RT...........R.......Y..........DDN....aHR..........DP..Y.EEA....Y......D..P....E....P..........Y.P..P.SP-...AH..H.QP.PVD.N--........YY.........PQ..G.N...Y.F...P........P....PPGS................TTN.......---.--....-LN....A..TPQP......YNP..AD...Y..P...PP......PGAA....P...P...P..Q..P.Y.A.Yg...........aaAP................GPGPETYA...PRPR.RAEENV............................................................................................
A0A084G042_PSEDA/442-486               ..................................RKRSR.........SR.S...I....AK....AA.L....A.T...A....A....T.A....G.V..L....K...H..LR....NR.SKSKS.R..............................SR.S..R..S..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------vksqs.......................................................................................
A0A319DBM7_9EURO/542-670               ..................................RHRSR.........SR.E...F....AE....AA.L....G.A...A....G....V.G....Y.A..A....H...K..LA....QR.NERKK.A..............................ER.D..R..D..RS...........-.......-..........DE-.....--..........--..-.EAA....Y......Q..H....D....P..........Y.P..S.SP-...AA..L.RP.IDD.HQ-........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....---....T..EPAP......YNP..AD...Y..P...PP......PGAV....P...P...-..Q..P.Y.A.H..............PA................RPESDPYA...PRPR.RVEENV............................................................................................
A0A0D2DIH2_9EURO/370-453               ...............................rrr-SRSRsss...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKSK.D..............................EG.D..R..G..RS...........R.......S..........RSR.....RR..........RE..S.VSS....L......E..D....D....P..........D.A..P.TD-...DA..R.NP.KHR.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnt.........................................................................................
A1DGB5_NEOFI/392-493                   ................................gsRSHSR.........LR.Q...A....--....LP.V....V.A...A....G....L.G....T.A..A....V...TglYE....KN.KEKKE.E..............................DG.K..R..R..ER...........R.......R..........SRS.....RS..........RA..P.SEA....Y......-..P....D....P..........A.R..D.SAGlieYG..Q.HP.VTG.S--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ipaahyygrpasqqgyysdasdr.....................................................................
A0A5N6UXE2_9EURO/566-609               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....A.G....Y.A..A....H...K..YS....QR.RERKK.A..............................EQ.E..R..E..RP...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------se..........................................................................................
A0A4S3JBJ6_9EURO/272-343               ...............................rsh-SRSR.........AK.T...F....AE....IG.L....G.A...A....A....I.AgavaL.A..R....H...H..SK....KD.KDGRR.-..............................SR.S..R..H..RR...........S.......A..........SV-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rskgdpdfekrsesqrkkhmt.......................................................................
A0A3M2T023_9EURO/244-303               .............................rsrsh-SHSR.........AK.T...F....AG....LG.L....G.A...A....A....V.A....G.A..V....A...L..AR....KK.SDSRR.R..............................SR.S..R..S..QH...........R.......R..........SSS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------stgeepdra...................................................................................
W9Y839_9EURO/636-791                   .................................gRRRS-.........SH.D...A....VK....TA.A....A.A...G....A....G.A....I.A..A....S...E..YE....RH.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........EEG....yGH..........DP..Y.EDN....Y.....nP..A....Q....P..........Y.P..P.TPP..pPA..N.DP.YAS.QQG........FY.........PQ..T.S...Q.F...P........P....PPGS................VPQq.....yPPQ.QT....TPT....A..GPAAg....tSYP..AQ..pY..P...PP......PPASg..pP...P...P..T..T.T.P.Y..............DA...............yGSGANPYA...PRG-.------penvs.......................................................................................
A0A439DIZ4_9PEZI/500-561               ..................................RSKSR.........SA.E...I....AA....AG.L....-.T...G....-....-.A....A.A..T....K...L..WE....RH.RDKK-.-..............................DR.E..N..H..AA...........S.......D..........DES.....--..........--..Y.SRD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsisrsrsrsrslgrh............................................................................
A0A063BU25_USTVR/461-568               ..................................RSKSR.........LR.R...A....AE....IG.G....V.A...A....A....A.G....V.A..N....K...L..WN....DH.KEKK-.-..............................DR.S..R..D..LS...........E.......S..........GDD.....--..........DY..Y.RRR....R......S..T....S....G..........R.R..R.SPS...GS..L.VE.YGT.D-P........LY.........PA..S.R...V.A...P........A....PRDL................DP-.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------eaedrraerrrrrrrdpsvs........................................................................
S7ZET0_PENO1/261-334                   .........................rsrsrsrsq-SHSR.........AK.T...L....LE....LG.L....G.A...Aa..vA....A.G....V.A..A....L...K..SK....SD.NDRRS.R..............................SR.N..R..S..HS...........R.......S..........GSR.....LR..........AL..S.RS-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsekdkdgeg..................................................................................
A0A1Y2EBN1_9PEZI/712-769               ..................................RSKSR.........LR.E...A....AA....GV.L....G.A...G....A....A.A....I.G..I....K...K..YN...dAK.KERSK.-..............................SR.E..R..S..RE...........R.......S..........PDE.....TE..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------eealrkedr...................................................................................
A0A1V6XYP1_PENNA/696-771               ..................................KHRSR.........SR.E...I....S-....SA.L....G.P...T....G....I.G....Y.A..A....H...K..YS....QH.KDRRN.P..............................-E.E..R..E..LF...........G.......K..........KES.....-T..........EV..S.RKR....F......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rscsddddaprgrtrtrynqdli.....................................................................
A0A1L9R783_ASPWE/382-487               ................................rsRSHSR.........FR.Q...A....--....LP.V....V.A...A....G....L.G....T.A..Aa..tG...L..YE....KS.QDRKK.Ege..........................dgSR.H..R..E..RR...........R.......S..........RSR.....SR..........TP..S.-EV....Y......-..P....D....P..........S.R..D.SAGlieYG..R.DP.VHG.S--........-I.........PT..A.N...Y.Y...G........R....SPSP................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sgyysdatdpv.................................................................................
Q0C9I2_ASPTN/296-361                   ...........................rsrsrsh-SHSR.........AR.T...F....AE....IG.L....G.A...A....AiagaV.A....L.A..R....N...K..SK...sDR.RSRSR.H..............................RR.S..A..S..V-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------kstregdekrsesq..............................................................................
B8NBW3_ASPFN/561-699                   ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YT....QR.RERKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aRQ..........DS..Y.GEP....Y......S..P....E....P..........Y.Q..H.TA-...--..L.PP.QSS.EHQ........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....-PA....G..STAP......YNP..AD...Y..P...PP......PVAV....P...P...S..Q..Q.Y.G.Y..............PP................-PGPESFV...SRPR.RADENV............................................................................................
A1CSM6_ASPCL/293-357                   ...........................rsrsrsh-SHSR.........AK.T...L....AE....IG.L....G.A...A....A....I.A....G.A..V....A...L..AR....KK.SKNDR.R..............................SR.S..R..H..RR...........A.......S..........SSS.....RP..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ekdaksekgs..................................................................................
E9DDF0_COCPS/287-350                   .................................t-SRSR.........AR.T...L....AG....LG.L....G.A...A....A....I.A....G.A..V....A...L..AK....KH.SEKSS.Q..............................QR.S..S..C..RR...........S.......R..........SHR.....RR..........SS..S.ASS....S......S..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dardpdh.....................................................................................
A0A2I2FP96_9EURO/386-501               ..............................rsrsRSQSR.........LR.Q...Vl.piAA....AG.L....G.T...A....A....A.T....G.L..Y....E...K..NK....EK.KGRKE.S.............................rHR.E..R..R..HS...........R.......S..........RSR.....SR..........AP..S.EPY....Y......S..E....G....P..........R.D..S.PGLi.eYG..E.DP.VHG.S--........-I.........PA..A.N...Y.Y...G........R....PASP................H--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gsypdssrhrhrnrsrg...........................................................................
A0A093Y5R9_9PEZI/1015-1087             ..................................RSRSR.........VR.D...V....VG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RR...........Y.......S..........S--.....--..........DS..Y.PSS....R......R..S....A....D..........Y.S..P.SP-...--..-.-P.HAS.GGA........YY.........PH..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------p...........................................................................................
A0A6A4K4H7_APOLU/128-259               ...........................etpteea-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..A....E...E..EEr..kKR.RKKKK.K..............................KR.R..R..R..RK...........L.......H..........GET.....TEs........iRI..Y.SCD....Y......Q..D....P....L..........D.P..L.TP-...TS..V.QP.KVI.PAI.......sEY.........SS..G.S...Q.F...P........L....PPCH................PQH......sSPN.SN....TPE....T..VTAP......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssntsqlpiseltnsdflqqsslctdhpatpnspy.........................................................
B6Q8Z7_TALMQ/273-331                   ...........................rsrsrss-SHSR.........AK.T...L....AG....IG.L....G.A...A....A....L.A....G.A..V....A...L..AR....NR.TQDDR.R..............................SR.S..R..H..RR...........R.......S..........QSR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ggdaas......................................................................................
C4JEK8_UNCRE/432-491                   ............................rskrsg--RSR.........SR.D...L....AT....AG.L...aA.A...G....A....A.G....I.A..A....H...E..YK....QR.KERKK.N..............................ER.D..R..G..MN...........K.......R..........KR-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ksrpvictm...................................................................................
A0A1B9FV19_9TREE/1-73                  ...............................mli-----.........--.-...-....-A....AG.I....R.A...G....V....K.G....Y.K..A....H...E..AK....KE.KERKE.-..............................EE.E..R..L..KS...........K.......K..........HPN.....AP..........PS..Y.TTH....P......S..N....E....P..........H.S..N.TA-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ykggfgtshspastpd............................................................................
C1HCJ5_PARBA/372-473                   ..................................RSRSR.........IR.Q..gL....PI....AA.A....S.L...G....S....A.A....I.A..G....-...L..YE....KH.KEKKE.N..............................ES.S..Q..R..HH...........R.......R..........RSR....sRS..........VV..P.SSA....Y......-..S....D....P..........S.G..S.APQlieYG..D.DP.VYG.S--........-I.........PT..N.H...Y.Y...G........R....P---................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssrqsspraiessf..............................................................................
A0A0D9NRE2_METAN/458-561               ................................rsRSKSR.........LR.R...V....AE....IG.G....V.A...A....A....A.G....V.A..N....K...L..WQ....NH.KEKKE.Ntrdls....................assddE-.-..-..Y..YR...........R.......R..........DSR.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srhrslsgsrhrsrsrsmarspysqpgadpelglveygndplypesrd............................................
A0A4Q4Z1G4_9PEZI/473-553               ................................hf--RSK.........SR.G...S....AE....IA.A....-.A...G....L....T.G....A.A..A....T...K..LW....ER.HKNKK.-..............................DR.K..K..D..RG...........-.......L..........DD-.....--..........AY..Y.SDG....R.....sR..S....R....S..........Y.S..R.SR-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrsrtrspfsrpsaadrel.......................................................................
A0A507QN43_MONPU/389-509               .................................g-HRSR.........SR.S...T....LQ....KA.Lp.iiA.A...G....V....G.S....A.A..V....A...S..YY...eKN.KGKKL.Er............................eER.S..R..R..RS...........R.......P..........ESE.....SR..........SR..S.RPR....S......V..C....N....S..........D.R..S.SP-...--..-.--.RD-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------taglieygehpvsgripaedyfgrpsspheyysdsvvplspgyrasrp............................................
A0A066XKL1_COLSU/488-525               ..................................KSKSR.........SR.S...V....AK....AA.A....AtA...A....A....A.G....L.V..Q....H...F..RD....KS.KSRSR.-..............................--.-..-..S..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rs..........................................................................................
A0A2S6CI98_9PEZI/562-653               ..................................RSKSR.........IR.TgvpI....AA....AG.L....-.-...G....G....A.A....L.A..G....L...-..YE....KN.KANKE.Akke........................aviED.E..L..N..RG...........R.......H..........RSR.....SR..........SR..S.ARH....P......D..M....I....A..........Y.G..H.EPI..hPE..D.RP.YYS.D--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------eepgryrrrg..................................................................................
A0A6P8BFX7_MAGGR/757-890               ......................vgfddrhmsper-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..-D....RN.REREE.R..............................AR.D..R..E..RR...........R.......Y..........EDE....iDDg........yDS..Y.DDR....Y......H..G....R....S..........H.P..P.SP-...--..-.-P.HAS.GGA........YI.........RP..A.M...S.G...A........A....GPGF................TSH.......PNI.AS....TNL....N..DYGG......YHP..AD...Y..G...GY.....pPNSA....P...T...P..T..G.M.P.P..............PPa.............gmPPTAPPYP...MDP-.------rppnn.......................................................................................
A0A3M2T023_9EURO/454-580               ..................................KHRSR.........SR.G...L....AG....AA.L....-.A...A....S....G.R....Y.A..A....H...K..FS....KQ.KDNKD.-..............................SR.D..P..D..RY...........G.......D..........GDG.....HY..........DS..Y.EDS....Y......H..P....E....P..........Y.P..P.SPP...PP..A.QP.MDN.NS-........YY.........SN..S.G...Y.Y...P........P....PNQP................---.......---.--....---....-..---P......---..--...Y..P...PP......PGAN....P...P...S..H..P.Y.G.Yp............sAP................APGPEAYA...PRPR.WADENV............................................................................................
A0A2B7XJD2_9EURO/551-701               ..................................RSRSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKK.A..............................EK.E..R..R..TY...........A.......H..........DHD.....YQ..........AP..Y.EEE....Y......E..P....A....A..........Y.A..P.SP-...--..-.-P.PNN.AN-........YY.........PQ..G.N...R.F...P........P....PPGP................TPV.......PP-.-P....PPN....V..QPGP......YNP..AD...Y..P...PP......PAAT....H...P...P..S..N.Y.P.Y..............PP................PPGGRA--...----.------denvsavptanptlsygqrqtss.....................................................................
S2JHI7_MUCC1/469-529                   .............................ndhhy-----.........KR.D...A....AI....GA.G....A.A...G....A....A.G....V.A..G....H...E..MK....EH.HDKEA.-..............................SS.N..R..T..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svssagsgekkgaavhdkplnt......................................................................
A0A0D2APJ8_9EURO/500-608               ................................reRSKSR.........VR.Q..aL....PV....VA.A....G.L...G....S....A.A....L.A..G....-...L..YE....KN.KAKKE.Aeqi.......................vkedRR.A..R..S..RS...........R.......S..........RAR.....SD..........AY..Y.DGP....R......E..G....A....I..........S.D..P.GLI..eYG..A.GP.MYG.NN-........YG.........PD..Y.Y...G.R...P........P....PPEG................Y--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ygasnavv....................................................................................
A0A5N6UXE2_9EURO/305-381               .......................rsrsrsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR...nKS.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........SS..V.RSG....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ttddekrsesq.................................................................................
A0A2B7Y2U2_9EURO/521-656               ..................................RKRSR.........SR.D...L....AT....AG.L....A.A...A....G....A.G....I.A..A....H...E..IT....QR.KERKR.A..............................EK.E..R..R..--...........E.......Y..........EDH.....--..........DS..Y.EEG....Y......D..P....A....P..........Y.P..P.PAG...GP..M.YP.PPG.N--........MY.........PQ..T.H...Q.F...P........P....PPGA................SPM.......P--.-H....PP-....-..PAAP......YAP..TA...Y..P...PP......PGAP...pP...P...Q..P..N.Y.T.Y..............PS................--PSDPYG...SRSV.PGDENV............................................................................................
A0A4Q4TAA7_9PEZI/548-607               ..................................RSRSK.........LR.N...V....AA....GV.L....G.T...G....A....A.A....I.G..I....K...K..YQ....DH.QKSKG.H..............................ERgE..R..P..RD...........R.......S..........RDV.....SR..........DR..S.QD-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rdrag.......................................................................................
A0A5N5K296_9PEZI/713-790               ..................................RSRSR.........LR.D...I....AA....GA.A....A.A...G....A....A.A....I.G..I....K...K..YQ...dNK.KEKEE.K..............................ER.S..R..E..RS...........R.......H..........RDQ.....RD..........RD..Q.DRD....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------drdrdrdrdydsedererqrq.......................................................................
K2S5L1_MACPH/581-741                   ..................................RSRSR.........SR.A...V....AE....AA.A....L.A...G....V....A.G....V.A..A....H...E..AA....KR.RERKK.A..............................EK.K..E..K..KR...........V.......E..........EER.....--..........PF..S.EDG....Y.....gS..P....P....P..........Q.G..Y.PPE..pYP..P.GP.YQP.DNG.......rYY.........PE..S.N...Q.F...P........P....PPQG................YDPa.....mQQN.VY....EPA....HygGPAP......YNP..AD...Y..G...PN......PGPT...qP...A...Y..A..H.Q.Q.Qap..........yfPPp.............prEPQQEYYD...DRGH.HHGDD-n...........................................................................................
A0A5N6EDR8_9EURO/563-702               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.REGKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aRQ..........DS..Y.GEP....Y......S..P....E....P..........Y.H..H.TA-...--..L.PP.QSS.EHQ........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....-PA....G..STAP......YNP..AD...Y..P...PP......PGAV....P...P...S..Q..Q.Y.G.Y..............PP................PPGPESFV...SRPR.RADENV............................................................................................
W9XLQ4_9EURO/374-457                   ............................rsrsrrRSRSRses...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....A...I..AS....KR.MNKDK.E..............................EP.R..R..S..RS...........R.......H..........RTQ.....--..........--..S.VSS....L......E..N....D....P..........S.A..P.SD-...DA..R.NP.KHR.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nkr.........................................................................................
A0A218ZBI5_9HELO/492-578               ..................................RSKSR.........IR.T...G....AE....IAgA....G.L...A....G....A.A....V.A.gL....Y...E..NH....KA.KDDRE.A..............................EA.E..D..E..RR...........S.......R..........RRS....rSR..........AR..S.IGA....Y......S..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dpgvdpelgmvqygaepvythhqttty.................................................................
A0A1L9X4X7_ASPA1/272-333               ...........................rsrsrsh-SHSR.........AR.T...L....AE....LG.L....G.A...AaiagA....V.A....L.A..R....N...K..SN....SN.KDRR-.-..............................SR.S..R..H..RR...........A.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asstrslplnk.................................................................................
A0A0D1ZLV8_EXOME/395-477               .......................rsrsrsrsrsa-SRSR.........LK.T...L....AT....AG.LgaaaL.A...A....V....A.T....I.A..T....K...K..LA....GN.KDQDQ.Dqe..........................ppRR.S..R..S..RR...........R.......R..........EET.....LT..........EL..E.ND-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ptaddarnpkh.................................................................................
A0A5N5DQ18_9PEZI/586-746               ..................................RSRSR.........SR.A...V....AE....AA.A....L.A...G....V....A.G....V.A..A....H...E..AA....KR.RERKK.A..............................EK.K..E..R..KR...........A.......E..........EER.....--..........PF..S.EEG....Y.....sSplP....A....G..........Y.P..P.EPF..pPG..A.YP.PEN.GR-........FY.........PE..S.N...Q.F...P........P....PPQGyd............pvMQQ.......PPY.EP....APF....G..GPAP......YNP..AD...Y..G...PN......PGPA...qPsyfP...Q..Q..Q.A.P.Y.............fPPp.............prEPQPEFHE...DRGH.HR----gddn........................................................................................
A0A0F8UEJ4_9EURO/277-347               .........................rsrsrsrsh-SHSR.........AK.T...F....AE....IG.L....G.A...A....A....I.V....G.A..I....A...L..AR....KQ.SSRSR.R..............................SH.S..R..H..RR...........G.......T..........SSSr...sVK..........DS..S.DNK....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqr.........................................................................................
W9XB18_9EURO/633-819                   .................................r-SRRR........hSR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....A...E..YE....KR.KQEKR.-..............................ER.R..A..R..RR...........R.......E..........EEG....yGR..........DP..Y.EDN....Y......N..P...gA....Q..........Y.A..P.TPPpppPV..N.DP.YAN.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................APQq....ypPQA.GP...gTAP....A..GGAQ......YPP..QN...Y..P...PPpp.pppPPGA....P...P...A..P..A.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsaepsstfgnpfaptvpsndqhhvpdg.............................................................
A0A4U0V3S5_9PEZI/482-561               ..............................rdrsKSLSR.........AQ.Q...L....GA....LA.A....V.T...A....V....G.A....L.A..G....Y...A..LK....KK.GNNET.Viik.......................deapRR.S..R..S..RR...........R.......R..........ASA.....-D..........SS..Y.TEN....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tmlsegggraldpeh.............................................................................
A0A439DIZ4_9PEZI/623-798               ..................................RSKST.........LR.D...V....AA....AG.L....G.T...A....A....A.A....I.G..I....K...K..LS....DH.QRNKE.Rgeissersvgqs.....rsrdrsdrardrrSR.D..R..E..RR...........R.......Y..........EEA....vAG..........SS..Y.YPS....Y......D..V....E....A..........P.P..P.SP-...--..-.-P.HAS.GGF........PP.........PP..T.N...Q.G...P........T....PVGPs.............afTNH......pNQS.TA....NLN....N..PYPP......YNP..QD...Y..A...NLp....pPPPG....P...P...P..A..S.A.S.Y.............fPP................-PGGPGHH...PG--.------penvsqvpn...................................................................................
A0A0B7N6U1_9FUNG/109-176               .............................hhykr-----.........--.-...-....-D....AA.L....T.A...G....A....T.G....P.A..G....H...E..LN....KH.HNNQP.K..............................PD.A..S..H..HN...........G.......I..........EST.....--..........-P..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hkddisdsktfepeighssagnrhe...................................................................
A0A1Y2VW00_9PEZI/673-815               ................................dr-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....E...E..YD....RE.RRKNR.R..............................SR.D..R..E..RR...........R.......Y..........EEE.....IP..........DP..Y.YDL....-......-..-....E....A..........G.A..P.SP-...--..-.-P.HAS.GGA........YYppp...phdP-..-.-...-.-...-........-....---Qadtpag...pagpggfTQHp....nlSTP.NV....NNY....T..PYQP......YNP..QD...Y..A...NLp...ppPTG-....P...P...P..P..P.G.-.-..............--................--------...----.------lnrsgpenvshphtgdvqshpdasrstateqd............................................................
G3XV77_ASPNA/301-373                   .........................rsrsrsrsh-SHSR.........AR.H...L....AE....LG.LgaaaI.A...G....A....V.A....L.A..R....S...K..SN....SN.KDRRS.R..............................SR.H..R..R..AS...........S.......S..........RRS.....LR..........DT..H.EEK....R......S..Q....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sqr.........................................................................................
Q0UZC8_PHANO/361-435                   ..................................RSKSR.........VR.E...I....GA....LA.A....I.A...G....V....G.A....L.A..Y....A...A..GR....KN.KDKGV.Tt...........................vvEE.H..R..H..RS...........R.......S..........RKS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rskrghsrrgrsrsvtvietdggps...................................................................
A0A1B8GNS0_9PEZI/548-704               ..................................RSRSR.........AR.D...V....LG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RH...........-.......-..........YSS.....--..........DS..Y.PSS....R......R..S....A....D..........Y.S..P.SP-...--..-.-P.HAS.GGA........YY.........PN..H.S...T.Q...P........PshpyPTTP................DPHp.....yPDA.NH....YG-....A..HPDP......NAP..TA...F..P...PP......PVP-....-...P...S..G..A.Y.H.A..............PPn..............gG--YEA--...----.------hsthsgpapggsagpghvnpdyygeta.................................................................
A0A0N0NRB6_9EURO/357-444               .........................rsrsrsrsq-SRSR.........LK.N...L....GL....LG.L....G.A...A....G....L.A....A.A..A....V...V..AT....KK.MKQNN.E.............................dKA.D..E..N..RG...........R.......S..........QSR.....VR..........TD..R.VET....I......E..E....L....A..........N.D..P.TAE...DA..R.NP.KHR.N--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------krma........................................................................................
A0A0D2E8L9_9EURO/644-800               ..............................rrqs-RRRS.........SR.D...A....TK....MA.A....A.A...G....A....G.A....V.A..A....S...E..YD....RR.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........EEGg...yGH..........DP..Y.EDS....Y.....nP..N....Q....Q..........Y.P..P.TPP..pPV..N.DP.YAS.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQ.......QQY.PP....QTS....N..PGAT.....tGNPygQA...Y..P...PP.....pPGPP....P...N...A..T..G.T.N.Y..............EA...............yASGANPYA...PRG-.------penvs.......................................................................................
A0A074W448_9PEZI/552-709               ..................................RSRSR.........TR.G...L....AE....GA.A....A.A...G....V....A.A....V.A..A....H...E..LG....KR.NERRR.Ad............................rER.D..R..D..RR...........R.......H..........EEE.....-D..........DM..Y.AHD....R......-..-....-....P..........Y.S..P.PPMganAA..Y.PP.TPQ.SHE........FY.........PA..T.N...T.F...P........P....PPTD................NYR.......-HQ.AD....YPP....Q..EYRP......YNP..AD...Y..P...PP......PAAT...sA...Pr.gR..Q..D.E.R.Y..............PSpdp.........nlgyPPANETFA...GDPR.YAGDN-r...........................................................................................
A0A4R8QR31_COLTR/503-609               ..................................RSKSR.........IR.T...G....AE....IA.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KDKKE.R..............................EI.E..R..E..LS...........-.......-..........DEE....yEE..........DL..R.RER....R......-..A....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrrsrsrsqarsiyseprsadpelglveygtsplprdppyplddgyasatd.........................................
A0A423VTZ9_9PEZI/757-827               ..................................RSKSR.........FR.E...M....AA....GA.A....A.A...G....A....A.A....I.G..L....K...K..YD...dAK.KEKEK.Kppve......................pipkER.S..R..E..RS...........R.......D..........RED.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------vglkerdrrakekad.............................................................................
A0A3A2ZU51_9EURO/303-366               ...........................rsrsrsh-SHSR.........AK.T...F....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....KK.SNSDR.R..............................SR.S..R..H..RR...........S.......-..........DSS.....AR..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------aepddarsqs..................................................................................
A0A6A6YH16_9PEZI/456-553               ................................ksRSRSR.........IK.TgvpI....AA....AG.L...aG.A...A....V....A.G....L.Y..E....R...Q..QA....RK.EEKLE.R..............................SR.S..R..S..RS...........R.......S..........VRS....gRR..........HS..T.SSD....T......A..L....V....E..........Y.G..G.EPI...YT..D.PP.VSS.HA-........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rhsrsrgydddpadr.............................................................................
A0A080WGP9_TRIRC/489-608               ..................................RSRSRhgn...gnlAA.G...L....AA....AS.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......Y..........DRD.....YR..........DP..Y.EEE....Y......-..P....S....P..........P.G..P.PPG..pAS..Y.QP.PAA.QE-........YYgvpp.ppgpPG..G.R...G.Y...P........P....PPGP................PP-.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gpgyfggpgpggppvyr...........................................................................
A0A5N6K0E4_9HELO/531-622               ..................................RSQSR.........VR.T...A....AE....IA.G...sG.L...A....G....A.A....V.A..-....G...L..YE....NR.KAKQE.Aeeddl...................ldrgerRR.S..R..T..RS...........R.......T..........RSR.....SR..........AR..S.TGV....Y......-..-....S....D..........P.G..V.DPE..lGM..P.AP.YDR.PNE........YE.........P-..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------av..........................................................................................
A0A3M9Y3F9_9PEZI/626-787               ..................................RSRSR.........IR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...E..YK....KK.KDAEK.Eredeaarra............rerslsrdySR.D..R..S..RR...........R.......D..........EDR.....--..........RR..Y.EEE....S......N..P....N....P.........hY.D..D.YSR...PP..S.PP.HAS.GG-........--.........--..-.A...Y.Y...P........P....PTGS................GFS.......--Q.NQ....SVN....D..PYPP......YSP..HA...YtgF...PP......PQPG...gP...P...T..-..-.-.-.-..............--................--------...----.------asgaaggfptptpggpplsypggpppi.................................................................
A0A3D8SX48_9EURO/529-662               ..................................RHRSR.........SR.D...L....AG....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YA....QH.RKE--.-..............................DR.D..R..E..RQ...........R.......Y..........DSD.....GP..........SP..F.EQP....F......S..P....S....P..........Y.P..P.SP-...-A..T.GP.VDS.SQ-........YR.........PN..-.N...Y.Y...P........P....PPGS................APT.......---.--....-PA....P..GPMP......YNP..AD...Y..P...PP......PNSG....P...P...P..Q..Q.Y.S.Y..............PP................-PAADAYA...PRPR.RADENV............................................................................................
A0A397HWZ0_9EURO/272-335               .........................rsrsrsrsh-SHSR.........AR.T...L....TE....IG.L....G.A...A....A....I.A....G.A..L....A...L..AH....KK.SNTDG.R..............................SR.S..R..H..RR...........S.......S..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sairpekdagse................................................................................
A0A0D2AI73_9PEZI/125-211               .....................svaaahfatglls-----.........--.-...-....--....--.-....K.A...A....I....I.A....G.G..V....Y...L..YK....QH.KDKKR.A..............................ER.T..S..E..HH...........R.......Y..........TDA.....-V..........DQ..N.TQD....Y......Q..P....P....K..........Y.N..D.YPS..dHK..S.QP.QV-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dyarksnpsyetmsn.............................................................................
A0A0P8X2H8_9CLOT/41-109                ............................nglkgd-----.........--.-...-....--....-G.A....F.G...G....G....A.P....F.A..Y....E...E..YE....GY.RNESR.K..............................EK.K..R..K..KK...........H.......R..........KHR.....DE..........RE..Y.EEA....Y......-..Q....N....D..........Q.S..Q.AP-...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------fippfnlddst.................................................................................
R8BUE6_TOGMI/744-875                   ...........................drerdrd-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....RE.RDRER.R..............................DR.D..R..E..RR...........R.......Y..........EEE.....TA..........AD..Y.DDA....Y......-..D....A....Q..........R.P..P.SP-...--..-.-P.HAS.GGA........YY.........PP..P.P...A.A...P........A...aPPAAaapy........gagfTQH......pNIA.TT....NLN....E..GYQP......YHP..ADytgY..P...PP......PPGP....P...P...S..H..P.Q.T.Pt...........gfPP................PPTGG---...----.------haagdnm.....................................................................................
H6C6Y6_EXODN/638-795                   .............................skhss-RRRS.........SR.D...A....AN....MA.A....A.A...G....A....G.A....I.A..A....S...E..YE....RR.KQEKR.-..............................ER.K..A..R..RR...........R.......E..........EEG....yGR..........DP..Y.EDN....Y.....nP..A....Q....P..........Y.P..P.TPP..pPA..S.DP.YAS.QQG........FY.........PQ..T.S...Q.F...P........P....PPGS................VPQq.....yPPQ.QS....TPS....A..GPPPa....aSYP..AQ..sY..P...PP......PPPG....G...P...P..T..T.T.P.Y..............DA...............yGSGANPYA...PRG-.------penvs.......................................................................................
A0A4V5NFE3_9PEZI/525-683               ...........................rtgrnte-----.........--.-...-....--....--.A....A.P...A....P....A.G....A.G..V....E...P..MR....LR.RDKNA.R.............................gQR.E..K..G..DV...........S.......Q..........GD-.....NI..........DP..Y.AHD....H......S..P....D....H..........Y.S..P.LG-...--..Y.PP.EE-.---........YY.........PQ..T.N...N.F...P........P....PPNA................GYA.......PP-.--....ADY....T..RQAP......YNP..SE...F..P...PP......PGMT....P...Q...P..QlvP.E.Q.F.............gHP................VHHP----...----.------nmtgealdphlgqypppreydpypgderyrgrgndpen......................................................
A0A2I1CLY0_ASPN1/380-480               ................................gsRSHSR.........LR.Q...A....--....LP.V....V.A...A....G....L.G....T.A..A....V...TglYE....KN.KEKKE.E..............................DG.K..R..R..ER...........R.......R..........SRS.....RS..........RA..P.SEA....Y......-..P....D....P..........A.R..D.SAGlieYG..Q.HP.VTG.S--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ipaahyygrpasqqgyysdasd......................................................................
A0A0D2BWC7_9EURO/625-785               ................................dr-SRRR........hSR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....T...E..YE....KR.KQERR.E..............................RR.A..R..K..RR...........E.......E..........EGY.....GR..........DP..Y.EDN....Y......H..PggqfA....P..........T.P..P.PPA...PV..N.DP.YAT.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQq....ypPQA.GP...aTAP....T..GAAP......YPP..QN...Y..P...PPp....pPPGA....P...P...A..P..A.Q.P.Y..............EA...............yASGANPYA...PRG-.------penvsae.....................................................................................
A0A0D1YR49_9PEZI/537-688               ..................................RSRSR.........SK.G...L....AE....VA.A....A.A...G....V....A.G....V.A..A....H...E..LT....KR.RERRR.-..............................--.E..R..E..RR...........R.......Q..........EEE....aAA..........AA..S.NSE....Y......T..S....T....T..........D.A..N.SP-...--..-.--.---.---........YY.........PA..S.N...H.F...A........P....PPNAaeg.........gyppMNH.......PND.SA....YYS....N..PVPP......YNP..AD...Y..G...PT......TGPT...lP...R...D..D..P.Y.A.Q..............PYnqqh.......hdnfaTPHQDPYS...PKN-.------kdprapen....................................................................................
A0A0D9NRE2_METAN/602-729               ..................................RSRSR.........LR.D...M....AA....AG.A....A.A...G....A....T.A....M.G..I....K...E..FK....DR.KDRKD.Qekrd......................rrsrER.D..D..E..RR...........R.......R..........EED....qRR..........DY..F.---....-......D..D....H....V..........R.P..H.SP-...--..-.-P.TAS.GGA........YY.........PP..-.-...-.Y...P........P....TPNGppmas.....ganrapYPD.......QNG.GA....PLQ....R..EYQP......YVP..QD...Y..T...G-......----....-...-...-..-..-.-.-.-..............--................--------...----.------yappp.......................................................................................
A0A0C9MGZ4_9FUNG/532-599               ..............................lsip-----.........-R.D...A....AI....GA.G....A.A...G....A....A.G....A.A..G....H...E..MK....EH.HDKKE.A..............................AS.G..R..T..S-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------vssassgekkgaavhdkplntggdahhva...............................................................
A0A2B7XC33_9EURO/568-706               ..................................RSRSR.........TR.D...F....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKR.A..............................EK.E..R..R..NY...........G.......P..........DND.....YQ..........DS..Y.EEG....Y......D..P....A....P..........Y.A..P.SP-...--..-.-P.PNG.AN-........YY.........PQ..G.N...Q.F...P........A....PPGS................TPI.......P--.--....-PN....S..QPAP......YNP..AD...Y..P...PP......PGA-....P...P...Q..A..Q.P.N.Yp...........pyPP................PPPMDPYA...PRPP.RGEDNV............................................................................................
A0A229X8A5_9EURO/372-477               ................................gsRSHSR.........LR.Q...-....-A....LP.V....V.A...A....G....L.G....T.A..A....I...TglYE....KN.KEKKE.E..............................EA.K..R..R..RR...........S.......R..........SRS.....--..........RA..P.SDI....Y......-..P....D....P..........A.R..D.SAGlieYG..Q.HP.VTG.S--........-I.........PA..A.H...Y.Y...G........R....PPSQ................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qgyysdasdrvardaa............................................................................
A0A168JB54_MUCCL/617-665               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKE-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sglegahhtsgnplhsgsgidnhh....................................................................
B4R4D9_DROSI/104-194                   ......................rssllvnsaltn-----.........--.T...V....AA....-A.A....A.A...A....A....A.A....V.A..S....N...T..LQ....QH.QQHHQ.Q..............................QQ.Q..Q..Q..QQ...........Q.......Q..........QQQ....qQQ..........QQ..Q.QQQ....H......S..P....Q....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qhliraipvsrfisarnvtrvannrhp.................................................................
T0KDB4_COLGC/626-696                   ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KK.KEKEE.Dd...........................rrS-.-..R..E..RS...........A.......R..........SRS.....RD..........R-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sisrdraysrdrasrdrvsr........................................................................
A0A0G4LM95_9PEZI/553-711               ..................................RSRSR.........IR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...E..YK....KK.KDAEK.Eredeaarra............rerslsrdySR.D..R..S..RR...........R.......D..........EDR.....--..........RR..Y.EEE....S......N..P....N....P.........hY.D..D.YSR...PP..S.PP.HAS.GG-........--.........--..-.A...Y.Y...P........P....PTGS................GFS.......--Q.NQ....SVN....D..PYPP......YSP..HA...Y..T...GF......PPPQ....P...-...-..-..-.-.-.-..............--................--------...----.------ggpstasgaaggfptptpggpplsypggp...............................................................
A0A074YSE8_AURPU/317-395               ..................................RSRSR.........AR.T...L....AK....VG.T....V.A...A....V....G.A....L.A..A....Y...A..LR....NR.GNKET.Vivnn.....................evpptRR.S..R..S..RR...........R.......R..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------asvgsvpppldarprsrseskhrdpe..................................................................
B2WNY2_PYRTR/600-753                   ..................................RSKSR.........AR.T...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........EDT.....--..........AY..S.TST....Y......-..-....S....P..........Y.D..S.PTS...ST..A.HP.DDS.R--........YF.........PE..T.N...Y.F...P........P....PPSA................---.......-PV.DH....NPN....N..PYPP......YNP..AD...Y..P...PG......PQST...yE...P...N..H..P.S.Q.Fv............nPPhndlhp...gnpyappQQQQDFYY...GQPR.HPDDNV............................................................................................
A0A3D8SX48_9EURO/383-496               ..................................RSRSR.........SK.S...K....IR....KA.LpvvaA.G...L....G....S.A....V.A..A....N...I..WD....KK.KDKEA.E..............................EE.P..R..R..KS...........R.......H..........RSR.....SR.........gRA..P.SDI....Y......-..P....D....P..........T.R..D.STGlieYG..D.HP.VHG.S--........-I.........PA..A.N...Y.Y...G........R....PPSS................QG-.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------yhtdasdrlardaglgs...........................................................................
A0A0F8UEJ4_9EURO/379-488               ..................................RSRSR.........SK.S...T....FR....KA.Lp..vV.A...A....G....L.Gt..aV.A..T....G...L..YE....KN.KEKRE.Se...........................eeSR.R..R..E..RR...........R.......S..........RSR.....-S..........RP..P.SEI....Y......-..P....D....P..........T.R..D.SAG..lIE..Y.GE.HPV.PG-........II.........PA..A.N...Y.Y...G........R....PASS................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qgyisdasdkvssg..............................................................................
A0A484G583_COLOR/1-63                  ..................................-----.........--.-...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KG.KDKEE.D..............................LR.E..R..E..RS...........R.......D..........RER.....RA..........RS..I.SRD....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsisrdrgyprdrass............................................................................
A0A5N5XDY5_9EURO/400-506               .................................sRSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KR.KEKQE.Egg.........................gssR-.-..K..E..RR...........R.......S..........ISR.....SR..........AP..-.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.R--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------iptadyygrptsqhgyysdasnpgtsg.................................................................
A0A420YNZ3_9PEZI/696-762               ..................................RSRSR.........LR.D...L....AT....GA.A....A.A...G....A....A.A....L.G..I....K...K..FQ...dSR.KEKEE.R..............................ER.S..R..D..RS...........R.......H..........ADD....rDR..........DR..D.DRD....Y......D..S....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dreryee.....................................................................................
H0EK30_GLAL7/634-744                   ..................................RSRSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.KEKKE.A..............................QR.E..R..E..RR...........R.......Y..........EEE....pPD..........DY..Y.SRD....Y......V..D....D....G..........Y.S..P.SP-...--..-.-P.HAS.GGS........FY.........PD..H.N...Q.F...Q........P....PQQP................AYT.......PGF.TQ....HPN....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lstpnrhnllmtp...............................................................................
J4UHD6_BEAB2/446-519                   ..................................RSKSR.........LR.T...G....AK....IA.G....A.A...A....A....A.G....V.A..G....K...L..YK....NH.QEKKE.R..............................ER.S..R..S..RA...........P.......S..........DDD.....--..........DR..Y.YDR....R......A..R....S....H..........S.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrsmarslhsdaga.............................................................................
E3QDR6_COLGM/476-516                   ..................................KSKSR.........SR.S...V....AK....AA.A....A.T...A....A....A.A....G.L..V....K...H..FR....DR.SKSK-.-..............................SR.S..R..S..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sk..........................................................................................
A0A3M6ZE02_HORWE/635-814               ..................................RSRSR.........AK.D...L....AG....AG.A....A.A...G....A....A.G....V.A..A....H...E..YG....KR.KERSR.Nreaesrss..............vgeerltyGV.G..R..E..DE...........R.......Y..........EDR.....YRg.......dgDH..Y.EPP....Y......D..H....P....G..........Y.L..P.-P-...QA..H.AP.YDN.RQ-........AY.........PG..G.N...Y.F...P........P....PPTD................DHVy.....dQAA.PP....QQP....N..PYPA......YNP..AD...Y..A...QG.....gPQHQ....P...Y...P..H..S.Y.G.A.............yDSeanl........gapyPGGNDTFA...GDTR.------yaptpehdgr..................................................................................
A0A4Q4WLE6_9PEZI/502-574               ..................................KHHHR.........GR.D...A....AL....AG.A....G.A...T....T....A.G....Y.G..A....H...M..YA....SR.DDEKQ.R..............................SP.Q..D..Y..AS...........S.......Y..........DVG.....--..........NP..Y.TQE....H......-..P....S....T..........P.S..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gtehgatylnygps..............................................................................
A0A5N6K0E4_9HELO/661-710               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YK....KR.KDRKE.R..............................QE.K..Q..E..KQ...........E.......K..........QEK.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rek.........................................................................................
Q0C9I2_ASPTN/595-690                   ...........................htvgpgy-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......-..........DD-.....RR..........EP..Y.EDP....Y......A..P....E....P..........Y.A..N.SP-...--..-.--.HDN.--Q........YY.........PN..S.N...Y.F...P........P....PPGS................APR.......---.--....-VA....G..TGPA......YNP..AD...Y..P...PP......PGAV....P...P...A..Q..P.Y.S.Y..............AT................PPAPEPYA...PRPR.RADENV............................................................................................
Q2TZD9_ASPOR/561-699                   ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YT....QR.RERKK.A..............................EQ.E..R..E..RP...........R.......F..........DED....aRQ..........DS..Y.GEP....Y......S..P....E....P..........Y.Q..H.TA-...--..L.PP.QSS.EHQ........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....-PA....G..STAP......YNP..AD...Y..P...PP......PVAV....P...P...S..Q..Q.Y.G.Y..............PP................-PGPESFV...SRPR.RADEN-g...........................................................................................
A0A1V8UUF7_9PEZI/407-490               ..................................RSKSR.........VR.Q...Y....GG....MA.A....V.A...A....A....G.A....L.A..G....Y...A..LM....KN.KGNKG.Etiiv.....................kegndRR.S..R..S..RR...........R.......A..........ASR.....DT.........gYL..S.GSS....F......R..S....R....S..........R.S..Q.SA-...--..L.NP.E--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nrnkr.......................................................................................
A0A100ITS5_ASPNG/401-507               ..................................RRESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................EE.S..R..R..RE...........R.......R..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SPG..lIE..Y.GD.H--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------pvhgsippnyygrpvsphgyysdasdpvas..............................................................
A0A178ZW35_9EURO/365-450               ...............................rhr-SRSRsss...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKSN.Dd............................gDR.G..R..S..RS...........R.......S..........RSR.....RR..........RE..S.VSS....L......E..N....D....P..........D.A..P.SD-...DA..R.NP.KHR.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnt.........................................................................................
A0A080WIC1_TRIRC/550-670               ................................enRSRSRhgn...gnlAA.G...L....AA....AS.L....-.A...A....G....A.G....Y.A..G....H...E..YA...kHH.RDQKH.-..............................--.S..N..G..RA...........E.......Y..........DRD.....YR..........DP..Y.EEE....Y......-..P....S....P..........P.G..P.PPG..pAS..Y.QP.PAA.QE-........YYgvpp.ppgpPG..G.R...G.Y...P........P....PPGP................PP-.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gpgyfggpgpggppvy............................................................................
A0A068RLC2_9FUNG/147-258               .............................gmstg-----.........-M.K...V....AA....GA.A....V.A...G....L....A.G....Y.G..I....A...E..FV...eHE.HEQSE.Rld..........................dlER.E..N.qE..LQ...........R.......Q..........QDE....lER..........EQ..Q.QQE....Y......Y..Q....Q....P..........P.P..P.PPP...AE..S.YP.PAG.ED-........-Yga.....ppPP..P.S...E.Y...P........P....PPEE................QGT.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tttiinedgg..................................................................................
A0A0S6X889_9FUNG/363-432               ..................................RSKSR.........IR.Q...L....GG....VA.A....V.A...A....V....G.A....L.A..G....Y...A..LR....NR.NKQQI.I.............................eRR.S..R..S..RH...........R.......R..........GSV....eRE..........EI..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ietggprsvddpkppdh...........................................................................
A0A0F4GXD0_9PEZI/399-461               ................................rsRSRSRsf.....nrTQ.K...L....GG....LA.A....V.A...A....V....A.A....L.G..A....Y...A..LK....NR.NNKET.Vi............................vKE.Q..P..P..RR...........R.......S..........EHR.....SP..........D-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hrnrr.......................................................................................
A0A5N6TGK4_9EURO/265-331               .........................rsrsrsrsq-SHSR.........AK.T...L....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....NK.SKDDR.Q..............................SR.S..R..H..HR...........S.......S..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------svrpertsdiekrge.............................................................................
A0A1Y2EBN1_9PEZI/591-662               ..................................RSKSR.........IR.T...G....AE....IA.A....A.S...L....T....G.A....A.A..S....K...L..WE....RH.KDKKA.-..............................-R.S..R..D..RE...........V.......-..........DDE.....--..........-Y..Y.SDR....-......-..D....R....R..........Y.S..P.SRS...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsrsrsrarshsrr..............................................................................
F7W3Z0_SORMK/439-492                   ..................................RSKSR.........AG.S...V....AK....AA.L....G.T...A....A....A.V....G.V..V....Q...H..IR....HK.RSKSR.H..............................-G.S..R..S..SS...........S.......S..........SD-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsghhsklk...................................................................................
A0A167BNN4_CORFA/444-514               ..................................RSKSR.........LR.T...G....AK....IA.G....A.A...A....A....A.G....V.A..G....K...L..YK....NH.QEKKE.K..............................ER.S..R..S..RA...........R.......S..........DTE.....-D..........DR..Y.HDR....R......D..R....S....R..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrsmarsfhs................................................................................
A0A165A7V2_XYLHT/98-169                ..................................RSHSR.........VK.E...L....AG....LG.L....G.A...A....A....I.A....A.A..V....S...F..AN....KN.NKKKN.Ddrg.......................drgeRR.S..R..S..RR...........R.......R..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hsvtgvdresraeskhrdpkh.......................................................................
A0A425BSJ7_9PEZI/306-354               .............................hhhna-----.........--.-...-....GK....AA.G....V.A...G....A....T.G....L.G..A....H...E..YK....KH.HDNKG.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ytgndnttgtgtgagytgn.........................................................................
G2QTJ0_THETT/500-538                   ..................................RSRSR.........AS.S...L....AK....AG.L....G.A...A....A....L.T....G.L..V....Q...H..YR...hKS.KSRD-.-..............................GK.S..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rs..........................................................................................
C4JEK8_UNCRE/210-276                   .................................s-SRSR.........AR.T...L....AG....LG.L....G.A...A....A....I.A....G.A..V....A...L..AK....KH.SEKNE.Krek........................sstRR.S..R..S..RR...........R.......R..........SSS.....-T..........SS..S.SDA....R......D..P....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ehrn........................................................................................
A0A1L9X4X7_ASPA1/524-652               ..................................RHRSR.........SR.E...F....AE....AA.L....G.A...A....G....V.G....Y.A..A....H...K..LA....QR.NERKK.A..............................ER.D..R..D..RS...........-.......-..........DE-.....--..........--..-.EAP....Y......Q..H....D....P..........Y.P..P.SP-...AA..P.RP.IDD.HQ-........YY.........PN..T.N...H.F...P........P....PPGS................APR.......---.--....---....T..EPAP......YNP..AD...Y..P...PP......PGAV....P...P...-..Q..P.Y.A.H..............PA................HPESDPYA...PRPR.RVEENV............................................................................................
A0A1J9R696_9EURO/540-581               ..................................RSRSR.........TR.E...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKK.A..............................EK.E..R..R..S-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------t...........................................................................................
A0A072PTE1_9EURO/382-455               ...............................rsh-SRSR.........LK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AT....KR.LGKKE.Tee..........................ppRR.S..R..S..RR...........R.......R..........EET.....LS..........EL..E.NDP....T......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------addarnpkhrnk................................................................................
A0A0C9MGZ4_9FUNG/321-378               ...hnnheginnphhsendklhqsssnndhhykr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....DR.H----.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gdanplq.....................................................................................
A0A0D1WQS0_9EURO/654-804               .................................h-SRRR.........SR.D...A....GR....SA.A....A.A...A....G....G.A....A.A..A....S...E..YE....SR.RKQEK.R..............................DR.K..A..R..KR...........R.......E..........EQG....yGA..........DP..Y.EDN....Y.....nP..A....Q....Q..........Y.S..P.TPP...PA..N.DP.YAT.QQG........FY.........PQ..S.S...Q.F...P........P....PPGA................VPQ.......QYP.QN....AAP....G..AANP......YPT..QS...Y..P...PPp....pPPGP....P...P...T..G..A.A.N.Y..............DP...............yASGANPYA...PRG-.------penvs.......................................................................................
A0A1Y2A0R4_9PLEO/591-736               ..................................RSKSR.........SR.K...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.VERKK.A..............................EK.E..R..Q..RQ...........-.......-..........EDS.....--..........AY..S.TSS....-......-..-....-....-..........Y.S..P.PPT...--..-.TA.LGS.DNR........YF.........PE..T.N...Y.F...P........P....PPTQ................-PV.......DPY.PP....QQA....A..PYTQ......YNP..AD...Y..P...PP......-QHV...rD...V...-..-..P.T.D.Yt............pPPpgpgm.....epgnpyAQHNQNPD...PRYR.RPDD--nm..........................................................................................
A0A218ZBI5_9HELO/610-761               ..................................RSRSR.........SR.S...V....AK....VA.A....G.T...A....A....A.A....I.G..I....N...K..YK....KK.KERKE.A..............................ER.E..R..E..RR...........R.......Y..........EEE.....EPp........gNY..Y.ARD....Y......-..Q....D....D..........Y.S..P.SP-...--..-.-P.HAT.GGS........YY.........PQ..S.N...A.F...P........P....PPQPg..............fTQHt.....tTST.TH....VHS....E..GIPP......YNP..AD...Y..A...HQ......PPYS...gH...Y...G..D..N.G.H.Yg............dN-................--------...----.------vsaynnshdhhhsvatgtgt........................................................................
A0A5J5EQA4_9PEZI/293-342               ..............................grhp-----.........GR.H...V....AV....AA.L....G.A...T....A....A.G....L.A..A....H...K..HF...eHR.RSQSR.G..............................SH.S..S..Y..PS...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------deeghksh....................................................................................
A0A1C1CTM8_9EURO/366-468               .................................s-KRSR.........SR.S...I....AA....RG.L....A.A...L....G....L.K....D.A..A....D...K..VD....PD.RERD-.-..............................-R.R..R..N..YD...........N.......Y..........DDD.....GR..........SS..R.YGG....Y......-..-....-....G..........Y.N..D.SRD..vGT..I.QP.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hydyanggprslsvprgapsgyeldygprhtgdpetd.......................................................
A0A5Q4BUL9_9PEZI/644-789               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..I....K...Q..YQ....KK.KEKDE.D..............................RY.-..-..-..--...........-.......-..........EES....vRD..........DG..Y.YDD....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGS........Y-.........--..-.-...-.Y...P........P....PPAPta............gfTQH.......PNIsTA....NLR....D..QYPP......-YP..QD...Y..P...PG......PPPM....G...P...S..P..P.M.A.Tgga........ggyPP................--------...----.------pppasgpppsggpppgtrfgpdhssq..................................................................
A0A0D2CID4_9EURO/379-467               ................................rrRSRSRses...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKNK.Nnd.........................dddRR.G..R..S..HS...........R.......S..........RSR.....RR..........AE..S.VSS....L......E..N....D....P..........D.A..P.SD-...DA..R.NP.KH-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrnt........................................................................................
A0A507QN43_MONPU/510-691               rsrsrtrsrsrsrarrnsrslssdsddhrrsrhq-RHSRp......ryLE.E...A....AA....VA.A....G.A...A....G....L.G....Y.A..A....H...E..YA....GH.KEHKK.A..............................EK.E..R..Q..ER...........E.......Y..........RRRg...sFE..........EP..Y.ESV....P......S..H....A....P..........Y.P..P.-PE...AS..A.LP.QVP.QGQ.......pAD.........DS..R.N...Y.Y...S........R....PPPS................GYV.......---.-P....PPA....A..PNAP......-YP..AD...Y..P...PP......PVAA....P...P...P..Q..P.Y.G.Y.............pRP................PPGADLYA...SRPR.SADD--mv..........................................................................................
A0A2B7XC33_9EURO/419-540               ..................................RSRSR.........VK.Q..gL....PI....AA.A....G.L...G....S....A.A....I.A..-....N...L..YE....KH.KEKKG.S..............................ES.T..E..R..RE...........R.......R..........QRRrs.rsRS..........VP..R.SPT....Y......-..-....-....-..........-.S..D.-P-...-S..R.SP.GQL.IEYgd....dpVYg......siPT..N.D...Y.Y...G........R....PPSR................PTSs.....pRAI.EA....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sprrssrhrsrsrprghy..........................................................................
A0A5M9JLR0_MONFR/716-766               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..M....N...E..YR....KR.KDRKE.K..............................QE.K..Q..E..KQ...........E.......K..........QEK.....Q-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ekr.........................................................................................
V5G1I1_BYSSN/557-696                   .................................g-SRSR.........SR.H...L....AE....AA.L....T.A...A....A....G.G....F.A..A....D...K..YA....KK.KERKK.A..............................EK.E..R..R..RH...........E.......S..........DED.....-Y..........DP..Y.EDQ....Y......D..P....E....P..........Y.T..P.PPP..pAG..A.AP.YD-.--H........YY.........PQ..T.N...S.F...P........P....PPAS................APA.......P--.--....-PQ....S..QPAP......YNP..GE...Y..P...PP......PGAA....P...P...P..Q..P.Y.G.Y..............QP................PPGPDPYA...PRPR.RADENV............................................................................................
A0A066XKL1_COLSU/524-653               ..................................RSKSR.........IR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KEKKD.R..............................E-.-..L..D..RE...........L.......S..........DDE.....YE..........EE..L.RRE....R......R..E....H....R..........R.S..R.SRSq.aRS..L.HP.EPR.NADsel.glveYGa.......sPL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......MSP..DD...Y..D...DR.....eP---....-...-...-..-..-.-.-.-..............--................--------...----.------akk.........................................................................................
E3RIR8_PYRTT/543-696                   ..................................RSKSR.........AR.T...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........DDS.....--..........AY..S.TGT....Y......-..-....S....P..........Y.D..S.PT-...-P..S.TA.HTN.DSR........YF.........PE..T.N...Y.F...P........P....PPSA................---.......-PV.DH....NPN....N..PYPP......YNP..AD...Y..P...PG......PQST...yE...P...N..H..P.S.Q.Fv............nPPhndlhp...gnpyappQQQQDFYY...GQPR.HPDDNV............................................................................................
A0A2D3UP02_9PEZI/340-415               ...........................tnrgrna-----.........--.-...I....GG....AA.L....G.A...A....G....V.-....E.A..A....S...R..LK....KT.KSLSR.Ffggs.....................esrsrSG.D..R..D..RD...........R.......Y..........EER.....YD..........DR..Y.DDR....R......D..R....R....K..........Y.R..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrsag.....................................................................................
A0A1V6T0F1_9EURO/543-688               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......H..........DDV.....HR..........DP..Y.EES....Y......D..P....E....P..........Y.P..P.SPQ..rAP..G.AP.PMA.DPH........YY.........PN..S.N...Y.F...P........P....PPGD................STY.......---.-N....LGG....G..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........avPP...............gGPGPDQYA...PRPR.RAEDNV............................................................................................
A0A364N2H0_9PLEO/341-403               ..................................RSKSR.........VK.E...L....GT....LA.A....I.A...G....V....G.A....L.A..Y....A...A..GQ....RN.KNKNK.Eetv.......................tiieDR.H..R..S..KS...........R.......S..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrgrrrsrsvsv................................................................................
L8G585_PSED2/503-624                   ..................................RSKSR.........TR.D...V....LG....GA.A....A.A...T....A....A.A....V.G..V....R...K..YK....AR.RKRRE.E..............................EA.A..R..E..RR...........-.......Y..........SS-.....--..........GS..Y.PSS....H......R..S....A....D..........Y.S..P.SPP...--..T.PP.AAP.TT-........--.........PT..TpP...N.L...P........P....TPTP................TRT.......HTQ.TQ....---....-..-TTA......HTP..TP...T..P...QP......P---....-...-...-..-..-.-.-.-..............--................--------...----.------shhllsrhrartmprrwg..........................................................................
A0A0G2EJI4_9EURO/487-587               ..................................RSRSR.........IR.TglpI....AA....AG.L....G.S...A....A....I.A....G.L..Y....E...K..NK....AK.REEQA.Aia.........................erkSR.S..R..T..RS...........R.......S..........RHS....vYP..........DS..S.RGA....I......S..D....Pn.miE..........Y.G..T.DPV...YG..A.IP.QQ-.--G........YY.........GQ..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sgapdsyydna.................................................................................
A0A1V6RB58_9EURO/690-760               ..................................KHRSR.........SP.E...I....SS....AA.L....D.V...T....G....L.G....Y.T..A....Q...K..YS....QH.KDRRK.-..............................SE.E..R..E..RS...........R.......N..........KER.....KE..........EV..S.RKR....L......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rscsdnddvprgrtrt............................................................................
A0A5Q4BUL9_9PEZI/510-642               ..............................rsrsRSKSR.........IR.T...G....AE....VV.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KEKKD.R..............................EV.D..R..ElsDQ...........E.......Y..........EEE....lRR..........ER..R.ERR....R......S..R....S....R..........S.Q..A.R-S...LY..P.EP.RSA.DPElg...lveYGt.......sPL..P.T...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------msgddyddaepak...............................................................................
A2QKM3_ASPNC/556-695                   ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.D..R..D..RP...........E.......S..........DED....aRR..........EP..Y.DSS....Y.....kN..P....L....P..........Y.P..A.TPA...AA..P.RP.IDD.HQ-........YY.........PN..G.N...Y.F...P........P....PPAT................GPR.......P--.--....---....-..EPAP......YSP..AD...Y..P...HP......PGPV....P...P...-..Q..S.Y.D.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
A0A178ZW35_9EURO/625-786               ...............................pdr-SRRR........hSR.D...A....AK....MT.A....A.A...A....A....G.A....I.G..A....S...E..YE....KR.KQERR.E..............................RR.A..R..K..RR...........E.......E..........EGY.....GR..........DP..Y.EEN....Y......N..P...gA....Q..........Y.A..P.TPPppaPV..I.DP.YAT.QQG........FY.........PQ..T.S...Q.F...P........P....PPGA................VPQq....ypPQA.GP...gVSP....A..GAAP......YPP..QN...Y..P...PPp....pPPGA....P...P...A..P..A.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsae.....................................................................................
A0A5N7DNY0_9EURO/414-513               ..................................RSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..A....G...L..YE....KH.KEKKE.E..............................-G.E..A..S..HR...........R.......A..........RSR....sRS..........RA..P.SEV....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PT..A.D...Y.Y...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grptsqqayysdasdp............................................................................
A0A2V1D6T8_9PLEO/401-446               ...............................npe---HR.........NR.R...A....AQ....IG.L...aS.A...A....V....A.G....V.V..E....H...Q..RN....KS.RERKG.-..............................ER.S..R..S..RV...........R.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tgi.........................................................................................
L8G585_PSED2/408-485                   ..................................RSKSR.........VR.T...G....AE....LA.A....A.G...L....A....T.A....A.A..A....G...L..YE....RR.KAKQE.Gergv.....................sslsrSK.S..R..S..RS...........R.......G..........GR-.....--..........-R..Y.DDD....Y......E..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rpglveygaqplhsrg............................................................................
A0A401L9C1_ASPAW/557-696               ..................................KHRSR.........SR.D...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..LS....QR.NERKK.A..............................DR.D..R..D..RP...........E.......S..........DED....aRR..........EP..Y.DSS....Y.....kN..P....L....P..........Y.P..A.TPA...AA..P.RP.IDD.HQ-........YY.........PN..G.N...Y.F...P........P....PPAT................GPR.......P--.--....---....-..EPAP......YSP..AD...Y..P...HP......PGPV....P...P...-..Q..S.Y.D.Y..............PS................GPGPDPYA...PRPR.RADENV............................................................................................
A0A0N0NRB6_9EURO/594-749               ..................................RRRSS.........RR.R...A....AD....AA.A....A.A...G....G....G.A....A.A..A....S...A..YE....RS.KAEKR.A..............................RK.E..A..K..RR...........E.......R..........EG-.....YA..........DQ..Y.EDP....Y.....nA..P....Q....Q..........G.Y..Q.PPV...DP..Y.AP.NAQ.QP-........YY.........QQ..P.G...A.F...P........P....PPGA................EQY.......---.-A....QPG....A..FPPP......-PP..GGp.pM..P...PP......PGA-....P...G...Y..E..P.Y.A.Yg............aNPn.............apT-------...----.------rgadnvsvplqnsipdgvntsrsmn...................................................................
A0A2D3UP02_9PEZI/408-486               ................................rs--RSRsag..gfsrKQ.T...L....GG....LA.A....V.A...A....V....G.A....I.A..G....Y...A..LK....NR.GNKE-.Tvivne....................apphrSR.S..R..R..RR...........H.......S..........YDD.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tevirtesearnpdhr............................................................................
F7W3Z0_SORMK/375-438                   ................................rsRSRSR.........SH.S...R....IK....TG.L....G.I...A....A....V.A....L.A..A....A...G..AA....KY.YESKK.Iek.........................eeaER.G..R..A..PR...........R.......Y..........SES.....--..........DY..Y.SR-....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------spsrk.......................................................................................
A0A167RTY9_9PEZI/522-665               ..................................RSHSR.........LR.T...G....AE....IA.A....-.A...G....L....A.G....A.A..A....K...K..LY...dRH.KDKK-.-..............................ER.E..R..E..LQ...........D.......C..........ELH.....ER..........GS..S.YDE....Y......D..G....Y....E..........S.D..R.RRRrrsGS..R.SR.SRS.RSA........PS.........PGavR.S...P.Y...P........P....PAGA................DAE......lG--.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lveygaqplymhpsqadpgrhgvrnyrggydsaaeasdpgsrrrh...............................................
A0A0F4YIE0_TALEM/339-441               ................................rsRSRSR.........IRkS...L....PI....VA.A....G.L...G....S....A.A....I.A..G....-...L..YE....KH.KEKKE.E..............................EA.A..A..E..RQ...........R.......R..........QSR.....SR..........SR..A.RSA....I......H..P....D....P..........T.R..E.SPGlieYG..N.DP.VYG.S--........-I.........PT..T.D...Y.Y...G........R....PATP................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------qgyysdavvp..................................................................................
M7SU52_EUTLA/431-503                   .................................r-HRSK.........SR.S...R....LK....TG.L....A.I...G....A....A.A....L.A..V....AgglK..YMq..dNK.VEKEE.A..............................NR.G..R..A..RR...........R.......Y..........SSG.....--..........--..-.--S....Y.....sR..S....P....S..........Y.G..H.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------skshskshsks.................................................................................
A0A3M7MC89_9PLEO/599-756               ..................................RSKSR.........AR.T...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..A..D..RR...........R.......E..........EDS.....--..........AY..S.TGT....Y......-..-....S....P..........Y.D..S.PTP...ST..A.HP.NDS.R--........FF.........PE..T.N...Y.F...P........P....PPSA................---.......PVD.QH....NPN....N..PYPP......YNP..AD...Y..P...PG......PQSSt..yE...P...N..H..P.S.H.F.............vNPqhndmhpgnpyappqqQQQQDFYY...GQPR.HPDDNV............................................................................................
A0A5J5EQA4_9PEZI/457-519               ....................rrrssstsstssta---SS.........SH.K...L....RN....VA.L....-.L...G....G....A.A....L.A..A....H...E..LH....KH.HKQRE.-..............................-R.E..R..T..P-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srpgilrrrsrths..............................................................................
C0NM90_AJECG/562-700                   ..................................RSRSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKR.A..............................EK.D..R..R..TY...........A.......H..........DHD.....YS..........DS..Y.EDG....Y......E..P....A....P..........Y.P..P.SP-...--..-.-P.SNG.PN-........YY.........AQ..G.S...Q.F...P........P....PPGA................APV.......P--.--....PPN....V..QPGP......YNP..AD...Y..P...PP......PGAA...pQ...P...P..S..N.Y.P.Y..............PP................PPGVDAYA...PRSA.RGDENV............................................................................................
C6HTC0_AJECH/382-462                   ......................kspgrirqgipi-----.........--.-...-....AV....AG.L....-.-...G....S....A.A....-.I..A....N...L..YE....KH.KEKKE.S..............................ES.-..S..E..RK...........E.......K..........NHR.....RRsr.....srsMA..R.SST....Y......-..P....D....P..........S.R..S.SPQ...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------lierssrrashs................................................................................
A0A0D1YR49_9PEZI/419-472               ................................rsRSRSR.........IR.QgvpI....VA....AG.L....G.S...A....A....V.A....G.L..Y....E...N..MK....AR.KEAKE.L..............................SR.S..R..S..RS...........Y.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrsr......................................................................................
A0A1V1TG51_9FUNG/508-578               ..................................RSKSR.........LR.T...G....AE....IA.A....-.A...G....L....T.G....A.A..A....T...K..LW...eRH.RDKK-.-..............................DR.E..N..H..AA...........S.......D..........DE-.....--..........-S..Y.SRD....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sisrsqsrsrslgrhhhtrds.......................................................................
A0A2V1D6T8_9PLEO/553-691               ..................................RSKSR.........TR.K...A....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AA....KR.RDRKK.A..............................EK.E..R..Q..RR...........E.......E..........DS-.....--..........AY..S.TGS....Y......-..-....-....-..........-.S..P.PPT...T-..-.A-.DGA.DPR........YF.........PQ..T.N...Y.F...P........P....PPHQ................SAD.......---.--....---....P..QYPP......YNP..AD...Y..P...AP......PQQNnypvP...P...P..Q..N.-.-.Ie...........ngPPy..............sPEPGNPYAhqdPRYR.RADDNV............................................................................................
A0A5J5EQA4_9PEZI/240-296               ...............................dph---RR.........AL.H...L....AE....AG.L....G.I...A....A....A.G....A.A..K....E...M..YD....AH.RRRAR.S..............................-R.A..S..Q..RS...........R.......S..........SS-.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tssnegrfgrhp................................................................................
C0NM90_AJECG/407-521                   .............rsksrsrkgekspgrirqgip-----.........--.-...I....AV....AG.L....-.-...G....S....A.A....I.-..A....N...L..YE....KH.KEKKE.S..............................ES.-..S..E..RK...........E.......K..........NHR.....RRsr.....srsMA..R.SST....Y......-..P....D....P..........S.R..S.SPQlieYG..D.DP.V--.---........-Yg......siPA..N.N...Y.Y...G........R....PPSR................QSS.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------spraieas....................................................................................
F9XE98_ZYMTI/303-350                   ..............................rsrsRSQSR.........KR.S...L....AT....GA.L....-.-...A....G....A.G....A.A..A....I...L..GQ....HR.KKQGH.E..............................ES.H..R..G..R-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------nvlgg.......................................................................................
A0A0J8RJW6_COCIT/510-554               ..................................RERSR.........SR.D...L....AT....AG.L...aA.A...G....A....A.G....L.A..A....H...K..YA....QR.KERKK.N..............................ER.D..R..T..S-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sil.........................................................................................
S3DTS4_GLAL2/689-740                   ..................................RSRSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.KEKKE.A..............................QR.E..R..E..RR...........R.......E..........DPS.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------tldlv.......................................................................................
A0A3N4L4M6_9PEZI/313-363               .............................hethn-----.........GR.N...V....AA....AA.L....G.A...T....A....T.G....L.A..A....H...K..MR....HH.KEHRS.Ss...........................vsS-.-..-..-..YS...........-.......S..........DDE.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rhskhr......................................................................................
F7W3Z0_SORMK/486-613                   .................................g-HHSK.........LK.T...G....AE....IV.A....A.G...V....A....A.G....V.A..K....K...A..YD....KH.KEKK-.-..............................ER.S..R..S..RH...........A.......A..........DDR.....DR..........EF..Y.DDD...gY.....dR..D....R....D..........Y.R..S.HSR...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------srsrsqhrsalpssqnnhasqrtvaddpeslglveygmnpvpvdsprddeqrqqqqshsksn..............................
A0A101ME85_9EURO/545-585               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSKE.R..............................ER.E..H..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sm..........................................................................................
A0A317X6X5_9EURO/401-507               ..................................RHESR.........SH.S...A....IR....KA.Lp..vV.A...A....G....L.G....T.A..A....A...TglYE....KN.KEKKE.E..............................ES.Q..R..R..ER...........R.......R..........SRS.....RS..........RA..P.SEA....F......-..P....D....P..........T.R..D.SPGlieYG..D.RP.VQG.S--........-I.........PA..A.N...Y.Y...G........R....PMSP................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hgyysdasdpvas...............................................................................
W9CAG8_SCLBF/706-866                   ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YR....KR.KDKKE.Kkekk.....................daekhER.E..R..E..RR...........R.......Y..........EDE....sSP..........ES..Y.YTN....F......R..D....E....G..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PD..N.I...Q.F...P........P....PPASapeg........fthhGNHs.....tPFI.NE....TP-....-..PIPP......YNP..QD...Y..A...GQ......RAAV....-...Q...D..P..H.V.N.Y..............PPs.............srAP------...----.------gdnvsayqssnsep..............................................................................
A0A1Y2VW00_9PEZI/623-681               ................................kkRSRST.........LR.D...V....AA....AG.L....G.T...A....A....A.A....I.G..I....K...K..YQ....DR.QKSKD.R.............................eDK.P..R..E..RS...........Q.......E..........RPQ.....DR..........EE..Y.DRE....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------r...........................................................................................
A0A168JB54_MUCCL/266-308               ................................kr-----.........--.-...-....-D....AA.L....G.A...G....A....A.G....L.A..G....H...E..LK....NH.HDKE-.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sglegahhtsgnplhpgs..........................................................................
A0A2I1CLY0_ASPN1/526-643               ..................................KHRSR.........SR.E...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YK....QS.RDRKR.-..............................-E.E..R..E..RS...........K.......Y..........DD-.....--..........DS..Y.PSD....L......-..-....-....P..........Y.P..P.SPV...PP..T.QP.VEN.P--........YY.........PN..S.N...Y.F...P........P....PPGS................TPA.......P--.--....---....-..---P......-LP..PR...H..I...IR......PIT-....-...-...-..-..-.L.L.H..............QP................--GPDRYA...PRPR.RADEN-v...........................................................................................
A0A7D8YMR6_9HELO/650-802               ..................................RSRSR.........VR.D...I....AG....AA.A....G.T...A....A....A.A....I.G..I....N...Q..YK....KR.REKKE.A..............................ER.E..K..E..RR...........R.......E..........DPQ....hSRsryeeespaeNY..Y.SRE....Y......-..-....D....D..........Y.S..P.SP-...--..-.-P.TAS.GGS........YF.........PQ..S.N...D.F...P........P....PPANp.............gyTQHp.....nQSS.PN....INQ....Q..PIPP......YNP..AD...Y..A...GP......PPA-....-...P...H..D..A.Y.G.H..............PP................QPRGDNVS...ASQ-.------yhnnv.......................................................................................
A0A010Q3X1_9PEZI/647-698               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..L....K...Q..YQ....KK.KEKEE.-..............................-E.R..R..E..ER...........R.......E..........ERR.....SR..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ersar.......................................................................................
A0A0D2I679_9EURO/381-460               ................................rrRSRSRses...pskLK.K...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AS....KR.MNKSN.-..............................DD.D..R..R..RS...........R.......S..........RHR.....RE..........SV..S.SLE....N......-..-....D....S..........D.A..P.SD-...DA..R.NP.R--.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------hrnk........................................................................................
A0A063BU25_USTVR/416-462               ................................rsRSRSK.........RR.S...L....ST....VA.K....A.A...L....G....T.A....A.T..A....G...I..IK....HI.RDKSK.S.............................kSR.D..R..S..RS...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rs..........................................................................................
A0A3M9Y3F9_9PEZI/511-601               ..............................rsrsRSKSR.........IR.Q...G....AE....VV.A....-.A...G....L....A.G....G.A..A....S...K..LW...hSR.KDKKE.A.............................kER.E..L..S..DE...........E.......Y..........EEE.....QR..........RR..D.RAA....R......R..L....V....E..........Y.G..T.DPL..pPS..Q.PP.YPT.ND-........Y-.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyesassq....................................................................................
A0A1C1CLL1_9EURO/496-603               ..................................RSRSR.........IR.Q..aL....PV....IA.A....G.L...G....S....A.A....V.A..G....-...V..YE....KH.KAKKE.Aeeivd...................knrrarSR.S..R..S..RA...........R.......S..........EH-.....-S..........AY..Y.DGP....P......P..P....P....T..........N.D..Q.SLV..eYG..N.TP.MYG.NN-........-Y.........GA..D.Y...Y.G...R........P....PPQE................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gyyssavvp...................................................................................
A0A4Z0YIZ2_9PEZI/606-661               ..................................RSKSR.........LR.G...V....AA....AG.L....G.T...A....A....A.A....I.G..I....K...K..YS....DH.QKNKE.R..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gatglvtvgheiasedvtrkk.......................................................................
W9WD84_9EURO/642-822                   ...............................rgg--RRH.........SR.D...A....AR....VT.A....A.A...A....A....G.A....A.G..A....S...E..AE....RR.RQERR.-..............................ER.R..A..R..RR...........Q.......H..........EEG....yGR..........DP..Y.EDN...nY.....aP..G....G....Q..........Y.A..P.TPP..pPA..H.DP.YAT.QQG........FY.........PQ..S.S...Q.F...P........P....PPGS................IPQq.....yPPQ.AG....PGM....A..PPPPgs..apYGQ..QG...Y..P...PPp....pPPGA....P...P...A..P..A.Q.P.Y..............DA...............yASGANPYA...PRG-.------penvsaepspvfgnpfapttpmndqnh.................................................................
A0A1L9X4X7_ASPA1/372-469               ..................................RDRSR.........SK.S...V....IR....KA.Lp..vL.A...A....G....L.G....T.A..A....A...TglYE....KN.KDKRE.A..............................SR.N..R..E..RR...........R.......S..........RSR.....SR..........AP..S.E-V....Y......-..S....D....P..........T.K..S.SPGlieYG..E.HP.VHG.SIPa......nYY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------grpgsshgyysd................................................................................
C1HCJ5_PARBA/521-660                   ..................................RSRSR.........TR.D...L....AT....AG.L....A.A...A....G....A.G....L.A..A....R...E..YT....QR.QERKK.A..............................EK.D..R..R..KY...........A.......R..........DHD.....YT..........DS..Y.EEG....Y......D..P....V....P..........R.V..P.SP-...--..-.-P.PNG.AN-........YY.........PH..S.N...H.F...P........P....PPGS................TPV.......P--.--....-PN....H..QGGP......YNP..AD...Y..P...PS......PGAP...pM...T...Q..A..N.Y.S.Yp............pPP................PPAADPYS...PRSI.KGEENV............................................................................................
A0A1L9RA18_ASPWE/478-646               .........rsrsrsrgvrygstsdsdqdsgrrrKSHHR.........SR.D...L....AG....AA.L....A.A...T....G....A.G....Y.A..A....H...K..YS....QR.KDRKK.A..............................GQ.D..R..D..RP...........G.......Y..........DDDn...vSR..........DP..Y.EES....Y......N..P....E....P..........Y.P..P.SPP...AA..P.QQ.QID.DRQ........YY.........PN..T.N...Y.F...A........P....PPSS................APH.......---.--....-PA....S..NGAP......YRP..AD...Y..P...PP......PGAA....P...P...P..Q..P.Y.G.Y..............PP................PPGPDPYA...PRPR.RADENV............................................................................................
A0A5N6Z5V7_9EURO/268-343               .....................rsrsrsrsrsrsy-SHSR.........AR.T...L....AE....LG.L....G.A...A....A....I.A....S.V..V....A...L..AR...nKP.KDERR.-..............................SR.S..R..H..RS...........R.......S..........RHH.....RS..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ssvrsgraadgekrs.............................................................................
A0A5N6UXE2_9EURO/415-515               ..................................RSHSR.........LR.K...A....LP....VV.A....A.G...L....G....T.A....A.A..T....G...L..YE....KH.KEKKE.Eg...........................esSR.R..R..E..RS...........R.......S..........RSR.....--..........-A..P.SEI....Y......-..P....D....P..........T.R..D.SAGlieYG..Q.DP.VHG.RI-........--.........PT..A.D...Y.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ygrptsqqayysdasdpa..........................................................................
A0A423W6A9_9PEZI/591-734               ...............................srsRSHSR.........LR.T...G....AE....IV.A....-.A...G....L....A.G....A.A..G....K...K..LY....DR.QKAKK.E..............................DR.E..R..D..LS...........S.......S..........DDE.....--..........DY..E.RDN....R......-..E....R....E..........R.S..R.SR-...RD..R.RA.SES.RSR........SR.........SR..S.R...S.R...P........P....PPST................---.......PAA.AA....DPE....L..GLVE......YGG..HP..lY..S...SP......PNPD....D...K...K..R..R.G.P.A.............gPP................EPGYDSAD...ERRR.RKR---er..........................................................................................
A0A2J6T2U0_9HELO/470-560               ................................gsRSKSR.........IR.T...G....AE....IA.A...aG.L...A....G....A.G....V.A..GlyenR...K..AK....ED.RETEE.V..............................EA.R..R..E..RR...........R.......S..........RSR.....--..........AR..S.VGT....Y......S..D....P....G..........V.D..P.ELGmvqYG..T.EP.VYT.HPG........YY.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dpal........................................................................................
K9FWG0_PEND2/544-691                   ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..HS...........K.......H..........DDN....vHR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..tAP..G.AP.PMA.DTH........YY.........PN..S.N...Y.F...P........P....PPGD................STY.......---.-N....LNG....G..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........aaPPg..............pGPRPEQHA...PRPR.RADDNV............................................................................................
A0A5N7BNB9_9EURO/565-608               ..................................KHRSR.........SR.D...L....TE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YS....QR.RERKK.A..............................EN.E..R..E..RP...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------se..........................................................................................
A0A2C5YVS7_9HYPO/279-338               ................................rkRSRSR.........LR.D...M....AA....AG.A....-.-...-....-....A.A....V.G..I....K...E..FK....DR.RDQEK.R..............................E-.K..R..S..RE...........R.......D..........EEL.....RS..........RS..M.DEE....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrlrfgde....................................................................................
V5G1I1_BYSSN/410-507                   ...............................ersRSRSR.........IR.Q...A....LP....IV.A....A.G...L....G....S.A....A.A..A....G...L..YE....KN.KAKKE.N..............................EE.G..R..Q..RR...........S.......R..........SRS.....R-..........SR..S.GTN....-......P..D....A....P..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rdsaglieygdrpvygnipeadyygrptspdgyysda.......................................................
A0A423W6A9_9PEZI/771-839               ..................................RSKSR.........LK.D...I....AA....GA.A....A.A...G....A....A.A....I.G..L....K...K..YE...dAK.KEKKQ.Aepp........................itrE-.-..R..S..RE...........R.......P..........RDR.....-E..........DS..G.ERE....R......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------ekkerarek...................................................................................
A0A2N3N5F7_9PEZI/644-721               .............................adsad-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..-E....RR.RERRR.R..............................DR.E..R..E..RR...........R.......Y..........EDE.....-E..........HY..D.ADR....Y......P..P....S....P..........P.H..A.SG-...GY..S.GP.RMS.GANadp.ndysSY.........PP..Q.T...Y.F...P........S....PPDT................T--.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dp..........................................................................................
A0A177CV39_9PLEO/1-101                 ...............................qed-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....--.-----.-..............................--.-..-..-..--...........-.......-..........---.....--..........--..-.-SA....Y......S..T....G....S..........Y.S..P.PP-...--..-.-P.GAE.DPQ........YF.........PQ..T.N...Y.F...P........P....PPTQ................---.......PVD.YS....NNN....N..NYPP......YNP..AD...Y..P...PPnn.gysPSNA...gH...I...H..P..A.T.G.Yt............pPP................PEPGNPYAhqdPRYR.RPDDNV............................................................................................
A0A3N4M4W7_9PEZI/469-578               ................................rsRSKSR.........HRiG...I....PE....AA.A....A.T..lI....G....A.G....I.A..G....E...R..AH....KK.HKEKK.R..............................EQ.E..M..H..GR...........G.......V..........AVP.....TG..........DP..H.PMH....H.....gS..S....S....P..........Y.A..H.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------pggslngggyaetidsdtttttiprdntpppqdrnrsrrass..................................................
A0A4U0TPH1_9PEZI/392-480               ..........................rrrsrsrs----Rgis...lsrAQ.K...V....GG....LA.A....V.A...G....V....A.A....L.A..G....Y...A..LK....NR.NKNNE.Tviv.......................netpRR.S..R..S..RR...........R.......R..........ASV.....--..........DS..Y.MSG....P......-..-....-....P..........L.S..E.RSG...SA..M.NP.KH-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rnkk........................................................................................
A0A139ISU8_9PEZI/658-831               ..................................RSRSR.........RR.H...L....AE....AG.A....A.A...G....V....A.A....V.A..A....H...E..IG....KR.RERSR.A..............................SR.S..R..E..GR...........R.......EyqpprvstasD--.....-Tdga...gpedDY..Y.DDR....R......P..D....D....P..........Y.A..P.PPM..gNS..Y.PP.YQN.QDPya....qqAY.........PG..A.N...Y.F...P........P....PPNG................ETS.......GYV.EP....QPA....Y..AHAQ......YNP..AD...Y..A...GQ......PATQ...aP...Y...D..H..Q.P.A.Yggy........gepHP................GQSHHNYA...HDAQ.YGD---egr.........................................................................................
A0A4U0TPH1_9PEZI/632-799               ..................................RSRSR.........GK.D...L....AA....AG.A....A.A...G....V....A.G....V.A..A....H...E..YG....KR.RERSR.-..............................HR.E..A..E..HR...........R.......R..........EDQ....vYD..........ER..Y.ARDheppY......D..P....S....G..........Y.L..P.PHQ...QP..N.AP.YDN.HQ-........VY.........PG..G.T...Y.F...P........P....PPTNda...........ayhEQQ.......PPI.HP....PEP....S..SYPV......YNP..AD...Y..A...HA......-GPQ....Q...P...Y..V..P.Y.-.-..............--................--------...----.------geggydaeeanlgapypggtetyagverfmpspep.........................................................
A0A1L9PHY0_ASPVE/333-462               ..............................rprsRSKSK.........VR.Q...A....IP....VV.A....A.G...L....G....S.A....V.A..A....N...V..WD....KR.KDKQA.E..............................EE.P..R..R..KD...........R.......R..........RSR....sRG..........RP..S.SEI....Y......-..P....D....P..........N.R..D.SAG..lIE..Y.GD.HPV.HG-........SI.........PA..A.N...Y.Y...G........R....PPSS................QGY.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rsdrgrtpsrsrsrarfsssspnsseedrrrr............................................................
A0A364N2H0_9PLEO/562-719               ..............................rsrsRSKGR.........AR.S...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AT....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........EDS.....--..........AY..S.TGT....Y......-..-....S....P..........Y.D..S.PTP...ST..A.HP.NDS.Q--........YF.........PQ..T.N...Y.F...P........P....PPNV................---.......-PV.DH....NAH....A..PYPP......YNP..AD...Y..P...PG......PQSA...yE...P...N..H..P.S.R.Yv............nPPhddvhv...gnpyappPQHHEPYY...GQPR.RTDGNV............................................................................................
E9E4W9_METAQ/602-663                   ..................................RSRSR.........LR.D...V....AA....AG.A....A.A...G....A....A.A....M.G..I....K...E..FK....DR.KDRKD.Q..............................EKrD..R..R..SR...........E.......R..........DDE.....RR..........N-..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------vvlvqktetdq.................................................................................
A0A135U1E0_9PEZI/692-844               ..................................RSRSR.........DR.S...V....TR....EG.T....Y.S...R....E....R.A....Y.S..R....E...R..ST....DD.RMRNR.-..............................ER.E..R..D..RR...........R.......Y..........EED....aRD..........DG..Y.YDN....Y......-..-....-....S..........R.P..P.SP-...--..-.-P.HAS.GGS........F-.........--..-.-...-.Y...P........P....PPAAag...........agfTQH......pNIS.TA....NLR....D..QYPP......YPS..SDs.vY..P...PG......PPPM....G...P...S..P..P.M.A.Tgga........ggyPP................--------...----.------pppaggppppdggpprtrfgpdh.....................................................................
A0A165A7V2_XYLHT/359-408               ..................................RSRSR.........SR.H...L....AE....AA.A....V.A...G....A....A.G....L.A..A....N...E..IG....KR.RERKK.Q..............................DK.E..R..R..Q-...........-.......-..........---.....--..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------inlfhrsrr...................................................................................
M3CFH9_SPHMS/555-643                   ................................rdRSKSR.........VR.T..gV....PI....AA.A....G.L...G....G....A.A....L.A..G....-...L..YE....KN.KANKE.Akkemv....................iedelNR.G..R..H..RS...........R.......S..........RSR.....SR..........RP..S.MVA....Y......G..D....-....-..........-.-..-.---...--..-.EP.IEH.G--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------drgyysdeepgry...............................................................................
M2TBE1_COCSN/587-741                   ..................................RSKSR.........AR.A...V....AE....TA.A....V.A...G....V....A.G....L.A..A....H...E..AT....KR.RDRKK.A..............................EK.E..A..E..RR...........R.......E..........EDS.....--..........AY..S.TST....Y......-..D....S....P..........Y.G..S.PT-...-A..S.TA.YTN.DSR........YF.........PE..T.N...Y.F...P........P....PPNA................---.......PAI.DP....NAH....S..PYPP......YNP..AD...Y..P...PP......PNTA...yE...P...N..H..P.S.Q.Yi............qPPhsdvhv....gnpyapPQPHDAYY...GQPR.RTDGNV............................................................................................
W9WD84_9EURO/379-466                   ................................rhRSRSRses...pskLK.T...L....GA....VG.L....G.A...A....A....L.A....A.A..A....T...I..AT....KR.MNKKN.Gdd..........................ddRR.G..R..S..HS...........R.......S..........RSR.....RR..........AE..S.VSS....I......E..N....D....P..........D.A..P.SD-...DA..R.NP.KH-.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------rrnt........................................................................................
A0A1G4B989_9PEZI/642-700               ..................................RSKSR.........LR.D...M....AA....AA.V....G.T...G....A....A.A....I.G..F....K...Q..YQ....KK.KEKDE.E..............................RR.S..R..E..RS...........A.......R..........SRS.....RD..........RS..V.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------trertys.....................................................................................
A0A395IIY0_9HELO/616-773               ..................................RSRSR.........VR.D...L....AA....GA.L....G.T...G....A....A.A....I.G..I....N...E..YK....KR.KDRKE.Kqekqekqer............rekrdaekhER.E..R..E..RR...........R.......Y..........EDE....aSP..........ES..Y.YTN....F......R..D....D....T..........Y.S..P.SP-...--..-.-P.HAS.GGS........YY.........PE..N.N...Q.F...P........P....PPTApdt.........fthhGNQs.....tPFV.NT....IP-....-..PIPP......YNP..QD...Y..A...GQ.....rPVH-....-...-...D..T..H.V.H.Y..............PP................VS------...----.------rtpgdni.....................................................................................
A0A1V6UUK8_9EURO/544-690               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..SS...........K.......H..........DDV.....HR..........DP..Y.EES....Y......D..P....E....P..........Y.P..V.SPQ...AP..G.AP.MAD.PH-........YY.........PN..N.N...Y.F...P........P....PPGD................STY.......---.-N....LNG....A..TPVS......YNP..AD...Y..P...PP......PGAA....P...P...-..Q..P.Y.A.Yg...........agPPgp............gpGPGPEQYA...PRPR.RAEDNV............................................................................................
A0A2I2G2G6_9EURO/272-339               ...........................rsrsrsh-SRSR.........AR.T...F....AE....LG.L....G.A...A....A....I.A....G.A..V....A...L..AR....QH.SNKGK.-..............................EK.D..G..R..RS...........R.......S..........RHR.....R-..........--..-.---....-......-..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------sgsvrskglpdaenr.............................................................................
A0A135U1E0_9PEZI/515-643               ..................................RSKSR.........IR.T...G....AE....IA.A....A.G...L....A....G.G....V.A..S....K...I..YK....NR.KEKKD.Re............................lDR.E..L..D..EQ...........D.......Y..........EEE....vRR..........ER..R.ERR....R......S..R....S....R..........S.Q..A.-RS...LY..S.EP.RSA.DPElg...lveYGt.......ePL..P.S...D.P...P........Y....PPDD................GYE.......SAA.NE....RRR....R..RHRR......MSG..DD...Y..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dghepak.....................................................................................
A0A0J8RJW6_COCIT/287-350               .................................t-SRSR.........AR.T...L....AG....LG.L....G.A...A....A....I.A....G.A..V....A...L..AK....KH.SEKSS.K..............................QR.S..S..G..RR...........S.......R..........SHR.....RR..........SS..S.ASS....S......S..-....-....-..........-.-..-.---...--..-.--.---.---........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------dardpdh.....................................................................................
U7PSX9_SPOS1/723-832                   ...........................dfdrdhd-----.........--.-...-....--....--.-....-.-...-....-....-.-....-.-..-....-...-..--....RQ.RDYDH.-..............................DE.D..V..N..HH...........R.......D..........DEE.....AY..........DG..Y.YDD....Y......-..D....N....S..........R.P..P.SP-...--..-.-P.HAS.GGA........FY.........P-..-.-...-.-...P........A....PPGGapig.......ttgglMQH......pNTA.TT....NLN....D..SYAP......YNP..VDysgY..P...PP......PGP-....P...P...-..-..-.-.-.-..............--................--------...----.------trgaadvq....................................................................................
A0A319A1B2_9EURO/520-648               ..................................RHRSR.........SR.E...F....AE....AA.L....G.A...A....G....L.G....Y.A..A....H...K..LS....QR.NERKK.A..............................ER.D..R..E..RS...........-.......-..........DE-.....--..........--..-.EGP....Y......Q..H....D....P..........D.P..P.SP-...AA..P.RP.IDD.HQ-........YY.........PN..T.N...Y.F...P........P....PPGS................APR.......---.--....---....T..EPAP......YNP..AD...Y..P...PP......PGAV....P...P...-..Q..P.Y.A.H..............PA................HPQPEPYA...PRPR.RVEENV............................................................................................
A0A135M0D6_PENPA/537-678               ..................................KHRSR.........SR.D...L....AG....AA.L....G.A...T....G....L.G....Y.A..A....H...K..YN....ER.RKSK-.-..............................ER.E..R..E..YK...........H.......D..........DNV.....HR..........DP..Y.EES....Y......D..P....E....P..........Y.P..L.SPQ..aAP..G.AP.PMA.DP-........HY.........PN..-.N...Y.F...P........P....GDST................YNL.......---.--....-NG....G..TPAP......YNP..AD...Y..P...PP......PCAA....P...P...-..Q..P.Y.A.Yga..........vpGP................GPGPEQYA...PRPR.RAEDNV............................................................................................
R8BUE6_TOGMI/546-644                   ................................ksRSRSR.........LR.T...G....AE....IV.A....-.A...G....L....A.G....A.A..G....K...K..LY...dRH.KDKKE.D..............................QR.E..R..-..-E...........L.......E..........ED-.....--..........EY..Y.DRE....R......R..R....S....R..........S.R..S.-RS...VA..R.AP.YPN.P--........--.........--..-.-...-.-...-........-....----................---.......---.--....---....-..----......---..--...-..-...--......----....-...-...-..-..-.-.-.-..............--................--------...----.------gtadpelglveygaqplyteppypeyay................................................................
Q4X209_ASPFU/555-690                   ..................................KHRSR.........SR.E...L....AE....AA.L....A.A...T....G....V.G....Y.A..A....H...K..YK....QS.RDRKK.-..............................-E.E..R..E..RS...........K.......Y..........DD-.....--..........DS..Y.PSS....Y.....pS..D....L....P..........Y.P..P.SPL...PP..T.QP.GEH.P--........YY.........PN..S.N...Y.F...P........P....PPGS................TPA.......---.--....-PP....A..PAAP......YNP..AD...Y..P...PP......PGAV....P...P...A..Q..P.Y.G.Y..............PP................EPGPDRYA...PRPR.RADENV............................................................................................
#=GC seq_cons                          ..................................+S+SR.........hR.s...h....At....su.h....u.A...u....u....s.u....h.A..s....p...p..hp....c+.+-++c.t..............................c+.p..R..p..Rp...........c.......p..........cpp.................p.....tp.....h....................................................................................................................................................................................................................................................................................tt..........................................................................................
//
DBGET integrated database retrieval system