GenomeNet

Database: Pfam
Entry: DUF3935
LinkDB: DUF3935
Original site: DUF3935 
#=GF ID   DUF3935
#=GF AC   PF13071.9
#=GF DE   Protein of unknown function (DUF3935)
#=GF AU   Mistry J;0000-0003-2479-5322
#=GF AU   Aldam G;0000-0003-3039-8438
#=GF SE   Pfam-B_1715 (release 24.0)
#=GF GA   81.00 81.00;
#=GF TC   149.00 148.80;
#=GF NC   26.30 21.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 61295632 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR025176;
#=GF DR   SO; 0100021; polypeptide_conserved_region;
#=GF CC   This family of proteins is functionally uncharacterised. This
#=GF CC   family of proteins is found in bacteria. Proteins in this family
#=GF CC   are approximately 90 amino acids in length. There are two
#=GF CC   conserved sequence motifs: FVF and LGV.
#=GF SQ   3
#=GS Q814U6_BACCR/2-71      AC Q814U6.1
#=GS A0A073KGP9_9BACI/2-71  AC A0A073KGP9.1
#=GS Q81JX7_BACAN/24-93     AC Q81JX7.1
Q814U6_BACCR/2-71                 TRLKQVFGIIISFFVFWFSMLGVQMFAEFLDIESLKFVAGKTEAARAFYSPYPFLIVFLITLLSLYFFVI
A0A073KGP9_9BACI/2-71             TKIKQFFGIILSFFIFWFSVLGIQRFAEFFDVSSLKFVEGKTAAARVFHSPYPFLIVFIITLLSLYFFVV
Q81JX7_BACAN/24-93                TRLKQVFGVIISFFVFWFSMLGVQMFAEFLDIESLKFVAGKTEAARAFYSPYPFLIVFLITLLSLYFFVI
#=GC seq_cons                     TRLKQVFGIIISFFVFWFSMLGVQMFAEFLDIESLKFVAGKTEAARAFYSPYPFLIVFLITLLSLYFFVI
//
DBGET integrated database retrieval system